KEGG   Mus musculus (mouse): 22157
Entry
22157             CDS       T01002                                 

Gene name
Tulp1, Tul, Tulp1l
Definition
(RefSeq) tubby like protein 1
  KO
K19600  tubby-related protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    22157 (Tulp1)
SSDB
Motif
Pfam: Tub DUF3527
Other DBs
NCBI-GeneID: 22157
NCBI-ProteinID: NP_067453
MGI: 109571
Ensembl: ENSMUSG00000037446
Vega: OTTMUSG00000024252
UniProt: Q9Z273
Position
17; 17 A3.3
AA seq 543 aa
MPLQEETLREVWASDSGHEEDCLSPEPPLRPKQRPAQGQKLRKKKPETPDSLESKPRKAG
AGRRKHEEPPADSAEPRAAQTVYAKFLRDPEAKKRDPRENFLVARAPDLGGEENSEEDSD
DDDNDDDEEEEEKKEGKKEKSSLPPKKAPKEREKKAKALGPRGDVGSPDAPRKPLRTKKK
EVGEGTKLRKAKKKGPGETDKDPAGSPAALRKEFPAAMFLVGEGGAAEKGVKKKGPPKGS
EEEKKEEEEEVEEEVASAVMKNSNQKGRAKGKGKKKVKEERASSPPVEVGEPREFVLQPA
PQGRAVRCRLTRDKKGMDRGMYPSYFLHLDTEKKVFLLAGRKRKRSKTANYLISSDPTNL
SRGGENFIGKLRSNLLGNRFTVFDNGQNPQRGGGGDVGSLRQELAAVVYETNVLGFRGPR
RMTVIIPGMNSDNERVPIRPRNASDGLLVRWQNKTLESLIELHNKPPIWNEDSGSYTLNF
QGRVTQASVKNFQIVHADDPDYIVLQFGRVAEDAFTLDYRYPLCALQAFAIALSSFDGKL
ACE
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgccactgcaggaggagacccttcgggaagtgtgggcctcagacagcggccatgaagag
gactgcttgagccccgagcccccgctgcgccccaaacagcgacccgcccagggacagaag
ttgaggaaaaagaaacccgagacccccgactccctggaatccaaaccccgtaaagctggg
gctgggcgcaggaagcacgaggagccgcccgcagactcggcagagccgcgcgctgcgcag
acagtctacgccaagttcctgagggaccccgaggccaagaagcgggacccccgggaaaac
ttcctagttgcccgcgccccagacctgggaggcgaggagaattcggaagaggattcggat
gatgatgacaatgatgatgatgaggaggaggaggagaagaaagaggggaaaaaagagaaa
agctctctgccccccaagaaagcacccaaggagagagagaagaaagccaaggctctgggc
ccaaggggggatgtaggaagcccggatgcccctcggaaaccgctccgaaccaagaagaag
gaggtaggggagggaaccaaactgagaaaggcaaagaaaaaagggcctggggagactgac
aaggaccccgcggggagcccagcagccttgaggaaggagtttccagcagccatgttcctg
gttggggaaggtggcgcggctgagaagggtgtgaagaagaaaggacctcctaaaggttca
gaggaagagaagaaggaggaggaggaagaagtggaagaggaggttgcatccgcagtgatg
aagaacagcaaccagaagggcagagctaaagggaaaggcaaaaagaaagtgaaggaggag
agagcctcttcgccccctgtggaagtgggtgaaccccgggagtttgtgctgcagccagca
ccccagggccgggcagtccgctgccggctgacacgggacaagaagggcatggatcgcggc
atgtacccgtcctacttcctgcacctggacactgagaagaaggtgtttctcctggccggc
aggaaacgcaagcggagtaagacagccaactatctcatctccagtgaccccaccaacctg
tcccggggaggcgagaatttcatcgggaagctgaggtctaatctcttggggaaccgcttc
acggtctttgacaacgggcagaacccacagcgagggggaggtggtgacgtgggaagcctg
cgccaggagctggccgctgtggtctatgaaaccaatgttttaggcttccgaggaccccgc
cgtatgactgtcatcattcctggaatgaactcggacaacgagagggtccctatccggccc
cgaaacgccagcgatgggctgctagtgcgctggcagaacaagaccctggagagtctcatc
gagctccataacaagccgcccatctggaatgaagacagtggctcctacaccctcaacttc
cagggccgcgtcacccaggcctccgtcaagaactttcagattgtgcacgctgatgaccct
gactatatagtgctgcagttcggccgcgtggctgaggacgccttcaccctagactaccgg
tacccgctgtgtgctctgcaggccttcgccatcgccctctccagcttcgacgggaagctg
gcctgcgagtga

DBGET integrated database retrieval system