KEGG   Mus musculus (house mouse): 22158
Entry
22158             CDS       T01002                                 
Symbol
Tulp3, 2310022L06Rik, AI316887
Name
(RefSeq) tubby-like protein 3
  KO
K19600  tubby and related proteins
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    22158 (Tulp3)
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    22158 (Tulp3)
Cilium and associated proteins [BR:mmu03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   22158 (Tulp3)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  Tubby family proteins
   22158 (Tulp3)
SSDB
Motif
Pfam: Tub Tub_N DUF3527
Other DBs
NCBI-GeneID: 22158
NCBI-ProteinID: NP_035787
MGI: 1329045
Ensembl: ENSMUSG00000001521
UniProt: O88413
Position
6:complement(128298103..128332833)
AA seq 460 aa
MEAARCAPGPRGDSAFDDETLRLRQLKLDNQRALLEKKQRKKRLEPLMVQPNPEARLRRL
KPRGSEEHTPLVDPQMPRSDVILHGIDGPAAFLKPEAQDLESKPQVLSVGSPAPEEGTEG
SADGESPEETAPKPDLQEILQKHGILSSVNYDEEPDKEEDEGGNLSSPSARSEESAAASQ
KAASETGASGVTAQQGDAQLGEVENLEDFAYSPAPRGVTVKCKVTRDKKGMDRGLFPTYY
MHLEREENRKIFLLAGRKRKKSKTSNYLVSTDPTDLSREGESYIGKLRSNLMGTKFTVYD
HGVNPVKAQGLVEKAHTRQELAAICYETNVLGFKGPRKMSVIIPGMNMNHERIPFRPRNE
HESLLSKWQNKSMENLIELHNKAPVWNDDTQSYVLNFHGRVTQASVKNFQIVHGNDPDYI
VMQFGRVADDVFTLDYNYPLCALQAFAIGLSSFDSKLACE
NT seq 1383 nt   +upstreamnt  +downstreamnt
atggaggcggcgcgctgcgcacccggaccccgcggggacagtgcctttgacgatgagacc
ctgaggcttcggcagctgaagctggacaatcagagggcactgctggagaagaagcagaga
aagaagcgccttgagccactcatggtacagccaaacccagaagccaggctgcgaaggtta
aagccacgaggcagtgaggagcacacgcctctggtggaccctcagatgcctcgcagcgac
gtcatcctacacggcatcgacggtccagctgctttccttaagccagaggctcaggatttg
gaaagcaagcctcaggttctctctgtgggctcccctgccccagaagaaggcacggaaggg
agtgcagatggggaaagccccgaggagacagcccccaagccagaccttcaggagattctc
caaaaacacggcatcttgagtagtgtgaactatgacgaggagcctgacaaggaggaagat
gaggggggaaacctcagctccccgtcggctcgctcagaggagagtgctgcagccagccag
aaagcagcctcggagacaggagcttccggtgtgacagcccagcagggtgacgcccagctt
ggagaagtggagaatttagaggactttgcgtatagccctgcccctcggggtgtcacggtg
aagtgtaaagtaaccagggataagaaaggcatggaccgtggcctcttccccacctactat
atgcacctggaacgggaggagaaccgcaagatatttcttctagccggtagaaagcggaaa
aagagcaaaacgtccaactacctggtctccacagacccgacagatttgtctcgtgaaggg
gaaagttacattggcaaactcagatccaatctcatggggaccaagttcacagtgtatgac
catggtgtcaacccagtcaaggcccagggtctggtggagaaggcccacacccgccaggag
ctggctgctatctgttatgaaacaaatgtcctcggtttcaaaggtcccaggaaaatgtct
gtgatcatcccggggatgaacatgaaccatgagcgcatccctttcaggccacgaaatgaa
cacgagagcttgctttcaaaatggcaaaacaaatccatggagaacctgatcgagctgcac
aacaaggccccggtgtggaatgacgacacccagtcctacgtgctgaactttcacggcaga
gtcacccaggcatccgtgaaaaacttccagatcgtccacgggaatgaccctgactacatc
gtcatgcagtttggacgcgtggctgatgacgtgttcacactggactataactacccactg
tgcgcacttcaagccttcgccatcgggctgtccagctttgacagcaagctggcgtgtgaa
tga

DBGET integrated database retrieval system