KEGG   Mus musculus (house mouse): 22166
Entry
22166             CDS       T01002                                 
Symbol
Txn1, ADF, Trx1, Txn
Name
(RefSeq) thioredoxin 1
  KO
K03671  thioredoxin 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05012  Parkinson disease
mmu05132  Salmonella infection
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    22166 (Txn1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    22166 (Txn1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    22166 (Txn1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    22166 (Txn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    22166 (Txn1)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Protein disulfide isomerase
   22166 (Txn1)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_8 Thioredoxin_7 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Glutaredoxin Thioredoxin_9
Other DBs
NCBI-GeneID: 22166
NCBI-ProteinID: NP_035790
MGI: 98874
Ensembl: ENSMUSG00000028367
UniProt: P10639
Position
4:complement(57943373..57956411)
AA seq 105 aa
MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSNVVFLEVDVD
DCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEASITEYA
NT seq 318 nt   +upstreamnt  +downstreamnt
atggtgaagctgatcgagagcaaggaagcttttcaggaggccctggccgccgcgggagac
aagcttgtcgtggtggacttctctgctacgtggtgtggaccttgcaaaatgatcaagccc
ttcttccattccctctgtgacaagtattccaatgtggtgttccttgaagtggatgtggat
gactgccaggatgttgctgcagactgtgaagtcaaatgcatgccgaccttccagttttat
aaaaagggtcaaaaggtgggggagttctccggtgctaacaaggaaaagcttgaagcctct
attactgaatatgcctaa

DBGET integrated database retrieval system