KEGG   Mus musculus (mouse): 22169
Entry
22169             CDS       T01002                                 

Gene name
Cmpk2, 1200004E04Rik, TDK, TDKI, Tyk, Tyki
Definition
(RefSeq) cytidine monophosphate (UMP-CMP) kinase 2, mitochondrial
  KO
K13809  UMP-CMP kinase 2, mitochondrial [EC:2.7.4.14]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00240  Pyrimidine metabolism
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Module
mmu_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    22169 (Cmpk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.14  UMP/CMP kinase
     22169 (Cmpk2)
SSDB
Motif
Pfam: Thymidylate_kin AAA_18 AAA_33 dNK MltA
Other DBs
NCBI-GeneID: 22169
NCBI-ProteinID: NP_065582
MGI: 99830
Ensembl: ENSMUSG00000020638
UniProt: Q3U5Q7
Position
12 A2; 12 9.69 cM
AA seq 447 aa
MALISRPRAPLWLGRLSRRLCGRHQACMGTMARPRRFTVELPDCSLTHFVLGDATDHRDA
RLAELLGPPGRSYALCVPLAPGEGCGPRVQAARVHHRLLQQLRRGPLQRCQLSKLLGYGP
GDQAGEAQHGFLLRDPCDHPDTRRDLLQLLGSCQEAARPQLAEFQADSQGLLWQRLWELQ
GDRQVQVDCACVLPAQEPHLHPLLPDLLNSAVFQDRDAARAVLEECTSFIPEARAVLDLV
DQCPKEVQKGKFQVIAIEGLDATGKTTLTQSVSESLKAVLLQSPPPCISQWRKIFDDEPT
IIRRAFYSLGNYLVASEIAKESTNFPVIVDRYWHSTATYAIATEVSGGLQYLPPAHHPVY
QWPGDLLKPDLVLLLTVNSEERVRRLQGRGQEKTKEEAELEANNVFRQKVEMTYQRMENP
SCHLVDASPSRETVLQKVLELIQSSGR
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggccctaataagccgccctcgagccccactgtggctcgggcgtctgtcgcggaggctg
tgcgggcgacaccaggcctgcatggggaccatggctcggccgcggcgcttcactgtggag
ctgccagattgctccctgactcacttcgtcctgggggatgcaacagaccacagggatgca
cgcctggcagagctgctcggccccccagggcgcagctacgcgctgtgtgtgcccctggct
ccaggcgaaggctgcgggccccgggtgcaggcggcccgggtgcaccatcgcctgctgcag
cagctgcgccggggtcctttacagagatgccaactgagcaagcttctgggctatggtccg
ggcgatcaggccggcgaagcccagcatggcttcctgctgcgggacccttgcgaccacccg
gacactcggcgcgacttgctccagcttctgggctcctgccaggaggcggcgcgcccgcag
ttggccgagttccaggccgactcccagggtttgctgtggcagcgtctgtgggagttgcag
ggagacaggcaggtgcaggtggactgcgcatgcgtcctgccggcacaggaacctcatctg
cacccattgctgccagatctgcttaactctgcggtgttccaagaccgggacgcggcaagg
gctgtcttggaagagtgcacatcctttattccagaagcccgggcagtacttgacctagtt
gaccagtgcccaaaggaggtccagaaagggaagttccaggtcattgccattgaaggactg
gatgccactggtaagaccacactgacgcagtcagtgtcagagtctctcaaggctgtcctc
ctacagtcgccacccccctgtatcagccagtggaggaagatctttgatgatgaacctact
atcattcgaagagccttttattctttgggcaattatctcgtggcttctgaaatagctaaa
gaatcaaccaactttcctgttattgtagacaggtactggcatagcacagccacctacgcc
atagctactgaggtgagtggaggcctacagtacctaccccctgcccaccaccctgtgtac
cagtggccaggggacctgctgaagcccgacttggtcctgctgctgactgtgaattctgag
gagagagtgcggagactgcagggccggggtcaggagaaaactaaagaagaggctgaactt
gaggccaataatgtgtttcgtcagaaggtggaaatgacgtaccagcgtatggagaaccca
agctgccatctggtggatgccagcccctcgagagagacagtcctgcagaaggttttagag
ctgatccagagttctggtcgttaa

DBGET integrated database retrieval system