KEGG   Mus musculus (mouse): 22171Help
Entry
22171             CDS       T01002                                 

Gene name
Tyms, Ts
Definition
(RefSeq) thymidylate synthase
  KO
K00560  thymidylate synthase [EC:2.1.1.45]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00240  Pyrimidine metabolism
mmu00670  One carbon pool by folate
mmu01100  Metabolic pathways
mmu01523  Antifolate resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    22171 (Tyms)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    22171 (Tyms)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    22171 (Tyms)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     22171 (Tyms)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymidylat_synt
Motif
Other DBs
NCBI-GeneID: 22171
NCBI-ProteinID: NP_067263
MGI: 98878
Ensembl: ENSMUSG00000025747
Vega: OTTMUSG00000024722
UniProt: P07607 Q544L2
Structure
PDB: 

Position
5 B1; 5 15.81 cM
AA seq 307 aa AA seqDB search
MLVVGSELQSDAQQLSAEAPRHGELQYLRQVEHILRCGFKKEDRTGTGTLSVFGMQARYS
LRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVRIWDANGSRDFLDSLGFSAR
QEGDLGPVYGFQWRHFGAEYKDMDSDYSGQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKD
LPLMALPPCHALCQFYVVNGELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLQPG
DFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLKILRKVETIDDFKVEDFQIEGYNPHPT
IKMEMAV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgctggtggttggctccgagctgcagtccgatgctcagcagctgagcgcggaagcccca
cggcatggagaactccagtacctgaggcaggtggagcacattttgcgctgcggcttcaag
aaggaggaccgcacgggcactggcaccctgtcggtgttcggcatgcaggcacgatacagc
ctgagagatgaatttcctctgctcacaaccaaacgagtgttctggaagggtgttttggag
gagttgttgtggtttatcaagggatccacaaatgctaaagaattgtcctcaaagggagtg
agaatctgggatgccaatggatcccgagattttctggacagcttgggattttctgcccga
caggaaggggacctgggcccagtttatggtttccaatggaggcattttggagcagagtac
aaagatatggattcagattactcgggacaaggagtagaccagctgcaaaaagtgattgac
accatcaaaaccaaccctgatgacagaagaatcatcatgtgtgcctggaacccaaaagat
cttcccctgatggcactgcctccttgccatgccctctgtcagttctatgtggtgaatggg
gaactgtcttgccagctttaccagaggtcaggagatatgggtctgggcgtgcccttcaac
attgccagctatgctctgctcacctacatgattgcacatatcacaggcctgcagccaggt
gattttgtccacactttgggagatgcacatatttacctgaatcatatagagccgctgaaa
attcagctacagcgagaaccaagacctttcccaaagctcaaaatccttcgaaaagttgag
acaatcgatgatttcaaagttgaagactttcagattgaagggtataatccacatccaacg
attaaaatggaaatggctgtttag

DBGET integrated database retrieval system