KEGG   Mus musculus (mouse): 22174Help
Entry
22174             CDS       T01002                                 

Gene name
Tyro3, AI323366, Brt, Dtk, Etk-2, Rse, Sky, TK19-2, Tif, etk2/tyro3, tk19-1
Definition
(RefSeq) TYRO3 protein tyrosine kinase 3
  KO
K05116  TYRO3 protein tyrosine kinase 3 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    22174 (Tyro3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     22174 (Tyro3)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  AXL family
   22174 (Tyro3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 I-set Ig_2 fn3 ig V-set C1-set Ig_5 DUF4229 Ig_4 Kinase-like
Motif
Other DBs
NCBI-GeneID: 22174
NCBI-ProteinID: NP_062265
MGI: 104294
Ensembl: ENSMUSG00000027298
Vega: OTTMUSG00000016527
UniProt: P55144
Structure
PDB: 

Position
2 E5; 2 59.97 cM
AA seq 880 aa AA seqDB search
MALRRSMGWPGLRPLLLAGLASLLLPGSAAAGLKLMGAPVKMTVSQGQPVKLNCSVEGME
DPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQS
VWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVL
NVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGAD
GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG
DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD
ELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV
PVVLGVLTALITAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER
IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK
MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD
LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC
VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ
TPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL
GHLSVLSTSQDPLYINIERAEQPTESGSPEVHCGERSSSEAGDGSGVGAVGGIPSDSRYI
FSPGGLSESPGQLEQQPESPLNENQRLLLLQQGLLPHSSC
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaggcggagcatggggtggccggggctccggccgctgctgctggcgggactg
gcttctctgctgctccccgggtctgcggccgcaggcctgaagctcatgggcgccccagtg
aagatgaccgtgtctcaggggcagccagtgaagctcaactgcagcgtggaggggatggag
gaccctgacatccactggatgaaggatggcaccgtggtccagaatgcaagccaggtgtcc
atctccatcagcgagcacagctggattggcttactcagcctaaagtcagtggaacggtct
gatgctggcctgtactggtgccaggtgaaggatggggaggaaaccaagatttctcagtca
gtatggctcactgtcgaaggtgtgccattcttcacagtggaaccaaaagatctggcggtg
ccacccaatgccccttttcagctgtcttgtgaggctgtgggtcctccagaacccgtaacc
atttactggtggagaggactcactaaggttgggggacctgctccctctccctctgtttta
aatgtgacaggagtgacccagcgcacagagttttcttgtgaagcccgcaacataaaaggc
ctggccacttcccgaccagccattgttcgccttcaagcaccgcctgcagctcctttcaac
accacagtaacaacgatctccagctacaacgctagcgtggcctgggtgccaggtgctgac
ggcctagctctgctgcattcctgtactgtacaggtggcacacgccccaggagaatgggag
gcccttgctgttgtggttcctgtgccaccttttacctgcctgcttcggaacttggcccct
gccaccaactacagccttagggtgcgctgtgccaatgccttgggcccttctccctacggc
gactgggtgccctttcagacaaagggcctagcgccagccagagctcctcagaatttccat
gccattcgtaccgactcaggccttatcctggaatgggaagaagtgattcctgaggaccct
ggggaaggccccctaggaccttataagctgtcctgggtccaagaaaatggaacccaggat
gagctgatggtggaagggaccagggccaatctgaccgactgggatccccagaaggacctg
attttgcgtgtgtgtgcctccaatgcaattggtgatgggccctggagtcagccactggtg
gtgtcttctcatgaccatgcagggaggcagggccctccccacagccgcacatcctgggtg
cctgtggtcctgggcgtgctcaccgccctgatcacagctgctgccttggccctcatcctg
cttcggaagagacgcaaggagacgcgtttcgggcaagcctttgacagtgtcatggcccga
ggggagccagctgtacacttccgggcagcccgatctttcaatcgagaaaggcctgaacgc
attgaggccacattggatagcctgggcatcagcgatgaattgaaggaaaagctggaggat
gtcctcattccagagcagcagttcaccctcggtcggatgttgggcaaaggagagtttgga
tcagtgcgggaagcccagctaaagcaggaagatggctccttcgtgaaagtggcagtgaag
atgctgaaagctgacatcattgcctcaagcgacatagaagagttcctccgggaagcagct
tgcatgaaggagtttgaccatccacacgtggccaagcttgttggggtgagcctccggagc
agggctaaaggtcgtctccccattcccatggtcatcctgcccttcatgaaacatggagac
ttgcacgcctttctgctcgcctcccgaatcggggagaacccttttaacctgcccctccag
accctggtccggttcatggtggacattgcctgtggcatggagtacctgagctcccggaac
ttcatccaccgagacctagcagctcggaattgcatgctggccgaggacatgacagtgtgt
gtggctgattttggactctctcggaaaatctatagcggggactattatcgtcagggctgt
gcctccaaattgcccgtcaagtggctggccctggagagcttggctgacaacttgtatact
gtacacagtgatgtgtgggccttcggggtgaccatgtgggagatcatgactcgtgggcag
acgccatatgctggcattgaaaatgccgagatttacaactacctcatcggcgggaaccgc
ctgaagcagcctccggagtgcatggaggaagtgtatgatctcatgtaccagtgctggagc
gccgaccccaagcagcgcccaagcttcacgtgtctgcgaatggaactggagaacattctg
ggccacctgtctgtgctgtccaccagccaggaccccttgtacatcaacattgagagagct
gagcagcctactgagagtggcagccctgaggtccactgtggagagcgatccagcagcgag
gcaggggacggcagtggcgtgggggcagtaggtggcatccccagtgactctcggtacatc
ttcagccccggagggctatccgagtcaccagggcagctggagcagcagccagaaagcccc
ctcaatgagaaccagaggctgttgttgctgcagcaagggctactgcctcacagtagctgt
taa

DBGET integrated database retrieval system