KEGG   Mus musculus (mouse): 22177
Entry
22177             CDS       T01002                                 

Gene name
Tyrobp, DAP, DAP12, K, KARAP, Ly83
Definition
(RefSeq) TYRO protein tyrosine kinase binding protein
  KO
K07992  TYRO protein tyrosine kinase binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    22177 (Tyrobp)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    22177 (Tyrobp)
SSDB
Motif
Pfam: DAP10
Other DBs
NCBI-GeneID: 22177
NCBI-ProteinID: NP_035792
MGI: 1277211
Ensembl: ENSMUSG00000030579
Vega: OTTMUSG00000059315
UniProt: O54885 Q3U419
Position
7 B1; 7 17.45 cM
AA seq 114 aa
MGALEPSWCLLFLPVLLTVGGLSPVQAQSDTFPRCDCSSVSPGVLAGIVLGDLVLTLLIA
LAVYSLGRLVSRGQGTAEGTRKQHIAETESPYQELQGQRPEVYSDLNTQRQYYR
NT seq 345 nt   +upstreamnt  +downstreamnt
atgggggctctggagccctcctggtgccttctgttccttcctgtcctcctgactgtggga
ggattaagtcccgtacaggcccagagtgacactttcccaagatgcgactgttcttccgtg
agccctggtgtactggctgggattgttctgggtgacttggtgttgactctgctgattgcc
ctggctgtgtactctctgggccgcctggtctcccgaggtcaagggacagcggaagggacc
cggaaacaacacattgctgagactgagtcgccttatcaggagcttcagggtcagagacca
gaagtatacagtgacctcaacacacagaggcaatattacagatga

DBGET integrated database retrieval system