KEGG   Mus musculus (mouse): 22178
Entry
22178             CDS       T01002                                 

Symbol
Tyrp1, Oc, Oca3, TR, TRP-1, TRP1, Ty, Tyrp, b, brown, isa
Name
(RefSeq) tyrosinase-related protein 1
  KO
K00506  tyrosinase-related protein 1 [EC:1.14.18.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00350  Tyrosine metabolism
mmu01100  Metabolic pathways
mmu04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    22178 (Tyrp1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    22178 (Tyrp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22178 (Tyrp1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.-  
     22178 (Tyrp1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of melanoma cells
   22178 (Tyrp1)
SSDB
Motif
Pfam: Tyrosinase TMEM154 Laminin_EGF Comm
Other DBs
NCBI-GeneID: 22178
NCBI-ProteinID: NP_001268943
MGI: 98881
Ensembl: ENSMUSG00000005994
Vega: OTTMUSG00000000391
UniProt: P07147 Q3UFS3
Position
4 C3; 4 37.89 cM
AA seq 537 aa
MKSYNVLPLAYISLFLMLFYQVWAQFPRECANIEALRRGVCCPDLLPSSGPGTDPCGSSS
GRGRCVAVIADSRPHSRHYPHDGKDDREAWPLRFFNRTCQCNDNFSGHNCGTCRPGWRGA
ACNQKILTVRRNLLDLSPEEKSHFVRALDMAKRTTHPQFVIATRRLEDILGPDGNTPQFE
NISVYNYFVWTHYYSVKKTFLGTGQESFGDVDFSHEGPAFLTWHRYHLLQLERDMQEMLQ
EPSFSLPYWNFATGKNVCDVCTDDLMGSRSNFDSTLISPNSVFSQWRVVCESLEEYDTLG
TLCNSTEGGPIRRNPAGNVGRPAVQRLPEPQDVTQCLEVRVFDTPPFYSNSTDSFRNTVE
GYSAPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNA
DISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYAYEVQWPGQEFTVSEIIT
IAVVAALLLVAAIFGVASCLIRSRSTKNEANQPLLTDHYQRYAEDYEELPNPNHSMV
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgaaatcttacaacgtcctccccctagcctatatctcccttttcctgatgctgttttat
caggtttgggctcagtttccacgagagtgtgccaatattgaggctctgagacgtggggtg
tgttgcccagacctgctcccttcctctggaccggggactgacccttgtggctcatcatca
ggaagaggcaggtgtgtggctgtgattgcagactcccgaccccacagccgccattatccc
cacgatggtaaagatgaccgagaagcctggcctctgaggttctttaatagaacatgtcag
tgcaatgataatttctcaggacacaactgtgggacttgccgtcctgggtggagaggagct
gcatgcaaccagaaaattctcacagtcaggagaaatcttctagacttaagtccagaagaa
aagagccactttgtcagggccttggatatggcgaagcgcacaactcaccctcaatttgtc
attgccacaaggaggttagaagacatactgggaccagatggcaacacaccacaatttgag
aacatttccgtttataactactttgtttggacacactattattcagtcaaaaaaaccttc
ctcgggacaggacaggaaagctttggggatgtggatttctctcacgaaggacccgctttt
ctcacatggcacaggtaccatctgctgcagctggagagagacatgcaggagatgctgcag
gagccttctttctcccttccttactggaattttgcaactgggaaaaacgtctgcgatgtc
tgcactgatgacttgatgggatccagaagcaacttcgattctactcttataagccccaac
tctgtcttttctcaatggagagtggtctgtgaatccttggaagagtacgataccctggga
acactttgtaacagcactgagggtggaccaatcaggagaaacccagctggaaatgtaggg
agaccagcagtgcagcgtcttcctgagccacaggatgtcactcagtgcttggaggtccgt
gtatttgacacacctcctttttattccaattctacagacagttttcgaaatacagtggaa
ggttacagtgctcccacgggaaaatatgaccctgctgttcgaagccttcacaacctggcc
cacctcttcctgaatggaacgggaggacaaacccatttgtctcccaatgatcctattttt
gtcctcctgcacactttcactgatgcggtctttgacgaatggctaaggaggtataacgcc
gatatttctaccttcccgttggaaaacgcacctattggacataacaggcaatacaacatg
gtgccattctggcctccagttaccaacacagaaatgtttgttactgctccagacaatctg
ggatatgcttatgaagttcaatggccaggtcaggagtttactgtatctgaaatcattacc
attgctgtagtggctgcgttgttacttgtagctgccattttcggggttgcttcttgtctg
atccgttctagaagcaccaagaatgaagccaaccagcctctcctcactgatcactatcaa
cgctatgctgaggactatgaggagctcccgaatcctaaccactccatggtctga

DBGET integrated database retrieval system