KEGG   Mus musculus (mouse): 22186
Entry
22186             CDS       T01002                                 

Symbol
Uba52, Cep52, D8Ertd21e, Gm1863, Rps27a, Ubb, Ubc
Name
(RefSeq) ubiquitin A-52 residue ribosomal protein fusion product 1
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03010  Ribosome
mmu04120  Ubiquitin mediated proteolysis
mmu04137  Mitophagy - animal
mmu05012  Parkinson disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    22186 (Uba52)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    22186 (Uba52)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    22186 (Uba52)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    22186 (Uba52)
   05167 Kaposi sarcoma-associated herpesvirus infection
    22186 (Uba52)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    22186 (Uba52)
   05022 Pathways of neurodegeneration - multiple diseases
    22186 (Uba52)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    22186 (Uba52)
   04121 Ubiquitin system [BR:mmu04121]
    22186 (Uba52)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    22186 (Uba52)
  Archaea
    22186 (Uba52)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   22186 (Uba52)
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 DUF2604 Ubiquitin_5 Dsc3_N
Other DBs
NCBI-GeneID: 22186
NCBI-ProteinID: NP_001335156
MGI: 98887
Ensembl: ENSMUSG00000090137
Vega: OTTMUSG00000033543
UniProt: P62984 Q5M9K3
Structure
Position
8:complement(70960913..70963067)
AA seq 128 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNN
LRPKKKVK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagaccctgacgggcaagaccatcactcttgaggtcgagcccagt
gacaccatcgagaatgtcaaggccaagatccaagacaaggaaggcatcccacctgaccag
cagaggctgatattcgcgggcaaacagctggaggatggccgcaccctgtccgactacaac
atccagaaagagtccaccttgcacctggtgctgcgtctgcgcggtggcatcattgagcca
tcccttcgtcagcttgcccagaagtacaactgtgacaagatgatctgccgcaagtgctac
gcacgcctgcaccctcgtgcagtcaactgccgcaagaagaagtgcggccataccaacaac
ctgcgccccaagaagaaggtcaaataa

DBGET integrated database retrieval system