KEGG   Mus musculus (mouse): 22186
Entry
22186             CDS       T01002                                 

Gene name
Uba52, Cep52, D8Ertd21, D8Ertd21e, Gm1863, Rps27a, Ubb, Ubc
Definition
(RefSeq) ubiquitin A-52 residue ribosomal protein fusion product 1
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03010  Ribosome
mmu04120  Ubiquitin mediated proteolysis
mmu04137  Mitophagy - animal
mmu05012  Parkinson disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    22186 (Uba52)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    22186 (Uba52)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    22186 (Uba52)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    22186 (Uba52)
   05167 Kaposi sarcoma-associated herpesvirus infection
    22186 (Uba52)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    22186 (Uba52)
   05022 Pathways of neurodegeneration - multiple diseases
    22186 (Uba52)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    22186 (Uba52)
   04121 Ubiquitin system [BR:mmu04121]
    22186 (Uba52)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    22186 (Uba52)
  Archaea
    22186 (Uba52)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   22186 (Uba52)
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 DUF2407
Other DBs
NCBI-GeneID: 22186
NCBI-ProteinID: NP_001335156
MGI: 98887
Ensembl: ENSMUSG00000090137
Vega: OTTMUSG00000033543
UniProt: P62984 Q5M9K3
Structure
PDB: 

Position
8 B3.3; 8 34.15 cM
AA seq 128 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNN
LRPKKKVK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagaccctgacgggcaagaccatcactcttgaggtcgagcccagt
gacaccatcgagaatgtcaaggccaagatccaagacaaggaaggcatcccacctgaccag
cagaggctgatattcgcgggcaaacagctggaggatggccgcaccctgtccgactacaac
atccagaaagagtccaccttgcacctggtgctgcgtctgcgcggtggcatcattgagcca
tcccttcgtcagcttgcccagaagtacaactgtgacaagatgatctgccgcaagtgctac
gcacgcctgcaccctcgtgcagtcaactgccgcaagaagaagtgcggccataccaacaac
ctgcgccccaagaagaaggtcaaataa

KEGG   Mus musculus (mouse): 22187
Entry
22187             CDS       T01002                                 

Gene name
Ubb, AL033289, Rps27a, Uba52, Ubb2, Ubc
Definition
(RefSeq) ubiquitin B
  KO
K04551  ubiquitin B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04137  Mitophagy - animal
mmu05012  Parkinson disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    22187 (Ubb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    22187 (Ubb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    22187 (Ubb)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    22187 (Ubb)
   05022 Pathways of neurodegeneration - multiple diseases
    22187 (Ubb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    22187 (Ubb)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22187 (Ubb)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   22187 (Ubb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   22187 (Ubb)
  Exosomal proteins of other body fluids (saliva and urine)
   22187 (Ubb)
  Exosomal proteins of colorectal cancer cells
   22187 (Ubb)
  Exosomal proteins of bladder cancer cells
   22187 (Ubb)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 DUF2407
Other DBs
NCBI-GeneID: 22187
NCBI-ProteinID: NP_001300913
MGI: 98888
Ensembl: ENSMUSG00000019505
Vega: OTTMUSG00000005857
UniProt: P0CG49 Q78XY9
Structure
PDB: 

Position
11 B2; 11 38.46 cM
AA seq 305 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGY
NT seq 918 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagaccctgaccggcaagaccatcaccctagaggtggagcccagt
gacaccatcgagaacgtgaaggccaagatccaggataaagagggcatcccccctgaccag
cagaggctgatctttgccggcaagcagctggaagatggccgcaccctctctgattacaac
atccagaaggagtcaaccctgcacctggtccttcgcctgagaggtggcatgcagatcttc
gtgaagaccctgaccggcaagaccatcaccctggaggtggagcccagtgacaccatcgag
aacgtgaaggccaagatccaggataaagagggcatcccccctgaccagcagaggctgatc
tttgccggcaagcagctggaagatggccgcaccctctctgattacaacatccagaaagag
tcaaccctgcacctggtcctccgtctgaggggtggcatgcagatcttcgtgaagaccctg
actggcaagaccatcaccctggaggtggagcccagtgacaccatcgagaacgtgaaggcc
aagatccaggataaagagggcatcccccctgaccagcagaggctgatctttgccggcaag
cagctggaagatggccgcaccctctctgattacaacatccagaaggagtcaaccctgcac
ctggtccttcgcctgagaggtggcatgcagatcttcgtgaagaccctgaccggcaagacc
atcaccttggaggtggagcccagtgacaccatcgagaatgtgaaggccaagatccaggat
aaagagggcatcccccctgaccagcagaggctgatctttgccggcaagcagctagaagat
ggccgcactctctctgattacaacatccagaaagagtcgaccctgcacctggtcctccgt
ctgaggggtggctattaa

KEGG   Mus musculus (mouse): 22190
Entry
22190             CDS       T01002                                 

Gene name
Ubc, 2700054O04Rik, AI194771, Rps27a, TI-225, Uba52, Ubb
Definition
(RefSeq) ubiquitin C
  KO
K08770  ubiquitin C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04137  Mitophagy - animal
mmu05012  Parkinson disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    22190 (Ubc)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    22190 (Ubc)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    22190 (Ubc)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    22190 (Ubc)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    22190 (Ubc)
   05022 Pathways of neurodegeneration - multiple diseases
    22190 (Ubc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    22190 (Ubc)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   22190 (Ubc)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 DUF2407
Other DBs
NCBI-GeneID: 22190
NCBI-ProteinID: NP_062613
MGI: 98889
Ensembl: ENSMUSG00000008348
Vega: OTTMUSG00000034016
UniProt: P0CG50
Structure
PDB: 

Position
5 G1.1; 5 64.18 cM
AA seq 734 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH
LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLED
GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEPSVTTKKVKQEDRRTFLT
TVSKKSPPCACSWV
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgcagatctttgtgaaaaccttaactggtaagaccatcaccctggaggtcgagcccagt
gacaccattgagaatgtcaaggcaaagatccaggacaaggagggcatcccccctgaccag
cagaggctgatctttgcaggcaagcagctggaagatggccgcaccctgtcagactacaac
atccagaaagagtccaccctgcacctggtccttcgcctcagaggtggcatgcagatcttt
gtgaagaccctgacaggcaagaccatcaccctggaggtcgagcccagtgacaccatagag
aatgtcaaggcaaagatccaggacaaggagggcatcccccctgaccagcagaggctgatc
tttgcaggcaagcagctggaagatggccgcaccctgtcagactacaacatccagaaagag
tccaccctgcacctggtccttcgcctcagaggtgggatgcagatctttgtgaagaccctg
acaggcaagaccatcaccctggaggtcgagcccagtgacaccatagagaatgtcaaggca
aagatccaggacaaggagggcatcccccctgaccagcagaggctgatctttgcaggcaag
cagctggaagatggccgcaccctgtcagactacaacatccagaaagagtccaccctgcac
ctggtccttcgcctcagaggtggcatgcagatctttgtgaagaccctgacaggcaagacc
atcaccctggaggtcgagcccagtgacaccattgagaatgtcaaggcaaagatccaggac
aaggagggcatcccccctgaccagcagaggctgatctttgcaggcaagcagctggaagat
ggccgcaccctgtcagactacaacatccagaaagagtccaccctgcacttagtccttcgc
ctcagaggtgggatgcagatctttgtgaagaccctgacaggcaaaaccatcaccctggag
gtcgagcccagtgacaccattgagaatgtcaaggcaaagatccaggacaaggagggcatc
ccccctgaccagcagaggctgatctttgcaggcaagcagctggaagatggccgcaccctg
tcagactacaacatccagaaagagtccaccctgcacctggtccttcgcctcagaggtggg
atgcagatctttgtgaagaccctgacaggcaagaccatcaccctggaggtcgagcccagt
gacaccatagagaatgtcaaggcaaagatccaggacaaggagggcatcccccctgaccag
cagaggctgatctttgcaggcaagcagctggaagatggccgcaccctgtcagactacaac
atccagaaagagtccaccctgcacctggtccttcgcctcagaggtggcatgcagatcttt
gtgaagaccctgacaggcaagaccatcaccctggaggtcgagcccagtgacaccatagag
aatgtcaaggcaaagatccaggacaaggagggcatcccccctgaccagcagaggctgatc
tttgcaggcaagcagctggaagatggccgcaccctgtcagactacaacatccagaaagag
tccaccctgcacctggtccttcgcctcagaggtgggatgcagatctttgtgaagaccctg
acaggcaagaccatcaccctggaggtcgagcccagtgacaccatagagaatgtcaaggca
aagatccaggacaaggagggcatcccccctgaccagcagaggctgatctttgcaggcaag
cagctggaagatggccgcaccctgtcagactacaacatccagaaagagtccaccctgcac
ctggtccttcgcctcagaggtggcatgcagatctttgtgaagaccctgacaggcaagacc
atcaccctggaggtcgagcccagtgacaccatagagaatgtcaaggcaaagatccaggac
aaggagggcatcccccctgaccagcagaggctgatctttgcaggcaagcagctggaagat
ggccgcaccctgtcagactacaacatccagaaagagtccaccctgcacctggtccttcgc
ctcagaggtggcatgcagatctttgtgaagaccctgacaggcaagaccatcaccctggac
gtcgagcccagtgttaccaccaagaaggtcaaacaggaagacagacgtaccttcctcacc
acagtatctaaaaagagccctccttgtgcttgttcttgggtgtga

KEGG   Mus musculus (mouse): 78294
Entry
78294             CDS       T01002                                 

Gene name
Rps27a, 0610006J14Rik, Uba52, Ubb, Ubc
Definition
(RefSeq) ribosomal protein S27A
  KO
K02977  ubiquitin-small subunit ribosomal protein S27Ae
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03010  Ribosome
mmu04120  Ubiquitin mediated proteolysis
mmu04137  Mitophagy - animal
mmu05012  Parkinson disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    78294 (Rps27a)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    78294 (Rps27a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    78294 (Rps27a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    78294 (Rps27a)
   05167 Kaposi sarcoma-associated herpesvirus infection
    78294 (Rps27a)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    78294 (Rps27a)
   05022 Pathways of neurodegeneration - multiple diseases
    78294 (Rps27a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    78294 (Rps27a)
   04121 Ubiquitin system [BR:mmu04121]
    78294 (Rps27a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    78294 (Rps27a)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    78294 (Rps27a)
  Archaea
    78294 (Rps27a)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   78294 (Rps27a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   78294 (Rps27a)
  Exosomal proteins of colorectal cancer cells
   78294 (Rps27a)
SSDB
Motif
Pfam: ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD DUF2407 Ubiquitin_5
Other DBs
NCBI-GeneID: 78294
NCBI-ProteinID: NP_001029037
MGI: 1925544
Ensembl: ENSMUSG00000020460
Vega: OTTMUSG00000005330
UniProt: P62983 Q642L7
Structure
PDB: 

Position
11; 11 A3.3
AA seq 156 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE
CPSDECGAGVFMGSHFDRHYCGKCCLTYCFNKPEDK
NT seq 471 nt   +upstreamnt  +downstreamnt
atgcagatctttgtgaagacccttacggggaaaaccatcacgctcgaggttgaaccctcg
gacactatagaaaatgtaaaggccaagatccaggataaggaaggaattcctcctgatcag
cagaggctgatctttgctggtaagcagctggaagatggccggactttgtctgactacaac
attcaaaaggagtccacccttcatctggtgttgagacttcggggtggtgctaagaaaagg
aagaagaagtcttacaccactcccaagaagaacaagcataagaggaagaaggttaagttg
gctgtgctgaaatactataaggtggatgaaaatggcaaaattagccgacttcgtcgagag
tgtccttctgatgaatgtggtgctggagttttcatgggaagccactttgacaggcattac
tgtggcaagtgttgtctgacttactgcttcaacaaaccagaagacaagtag

DBGET integrated database retrieval system