KEGG   Mus musculus (mouse): 22187Help
Entry
22187             CDS       T01002                                 

Gene name
Ubb, AL033289, Rps27a, Uba52, Ubb2, Ubc
Definition
(RefSeq) ubiquitin B
  KO
K04551  ubiquitin B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04137  Mitophagy - animal
mmu04144  Endocytosis
mmu05012  Parkinson disease
mmu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    22187 (Ubb)
   04137 Mitophagy - animal
    22187 (Ubb)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    22187 (Ubb)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    22187 (Ubb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    22187 (Ubb)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22187 (Ubb)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   22187 (Ubb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   22187 (Ubb)
  Exosomal proteins of other body fluids (saliva and urine)
   22187 (Ubb)
  Exosomal proteins of colorectal cancer cells
   22187 (Ubb)
  Exosomal proteins of bladder cancer cells
   22187 (Ubb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 DUF2407
Motif
Other DBs
NCBI-GeneID: 22187
NCBI-ProteinID: NP_001300913
MGI: 98888
Ensembl: ENSMUSG00000019505
Vega: OTTMUSG00000005857
UniProt: P0CG49 Q78XY9
Structure
PDB: 

Position
11 B2; 11 38.46 cM
AA seq 305 aa AA seqDB search
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcttcgtgaagaccctgaccggcaagaccatcaccctagaggtggagcccagt
gacaccatcgagaacgtgaaggccaagatccaggataaagagggcatcccccctgaccag
cagaggctgatctttgccggcaagcagctggaagatggccgcaccctctctgattacaac
atccagaaggagtcaaccctgcacctggtccttcgcctgagaggtggcatgcagatcttc
gtgaagaccctgaccggcaagaccatcaccctggaggtggagcccagtgacaccatcgag
aacgtgaaggccaagatccaggataaagagggcatcccccctgaccagcagaggctgatc
tttgccggcaagcagctggaagatggccgcaccctctctgattacaacatccagaaagag
tcaaccctgcacctggtcctccgtctgaggggtggcatgcagatcttcgtgaagaccctg
actggcaagaccatcaccctggaggtggagcccagtgacaccatcgagaacgtgaaggcc
aagatccaggataaagagggcatcccccctgaccagcagaggctgatctttgccggcaag
cagctggaagatggccgcaccctctctgattacaacatccagaaggagtcaaccctgcac
ctggtccttcgcctgagaggtggcatgcagatcttcgtgaagaccctgaccggcaagacc
atcaccttggaggtggagcccagtgacaccatcgagaatgtgaaggccaagatccaggat
aaagagggcatcccccctgaccagcagaggctgatctttgccggcaagcagctagaagat
ggccgcactctctctgattacaacatccagaaagagtcgaccctgcacctggtcctccgt
ctgaggggtggctattaa

DBGET integrated database retrieval system