KEGG   Mus musculus (mouse): 22190Help
Entry
22190             CDS       T01002                                 

Gene name
Ubc, 2700054O04Rik, AI194771, Rps27a, TI-225, Uba52, Ubb
Definition
(RefSeq) ubiquitin C
  KO
K08770  ubiquitin C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    22190 (Ubc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    22190 (Ubc)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitins
   22190 (Ubc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 DUF2407
Motif
Other DBs
NCBI-GeneID: 22190
NCBI-ProteinID: NP_062613
MGI: 98889
Ensembl: ENSMUSG00000008348
Vega: OTTMUSG00000034016
UniProt: P0CG50
Structure
PDB: 

Position
5 G1.1; 5 64.18 cM
AA seq 734 aa AA seqDB search
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH
LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLED
GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEPSVTTKKVKQEDRRTFLT
TVSKKSPPCACSWV
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgcagatctttgtgaaaaccttaactggtaagaccatcaccctggaggtcgagcccagt
gacaccattgagaatgtcaaggcaaagatccaggacaaggagggcatcccccctgaccag
cagaggctgatctttgcaggcaagcagctggaagatggccgcaccctgtcagactacaac
atccagaaagagtccaccctgcacctggtccttcgcctcagaggtggcatgcagatcttt
gtgaagaccctgacaggcaagaccatcaccctggaggtcgagcccagtgacaccatagag
aatgtcaaggcaaagatccaggacaaggagggcatcccccctgaccagcagaggctgatc
tttgcaggcaagcagctggaagatggccgcaccctgtcagactacaacatccagaaagag
tccaccctgcacctggtccttcgcctcagaggtgggatgcagatctttgtgaagaccctg
acaggcaagaccatcaccctggaggtcgagcccagtgacaccatagagaatgtcaaggca
aagatccaggacaaggagggcatcccccctgaccagcagaggctgatctttgcaggcaag
cagctggaagatggccgcaccctgtcagactacaacatccagaaagagtccaccctgcac
ctggtccttcgcctcagaggtggcatgcagatctttgtgaagaccctgacaggcaagacc
atcaccctggaggtcgagcccagtgacaccattgagaatgtcaaggcaaagatccaggac
aaggagggcatcccccctgaccagcagaggctgatctttgcaggcaagcagctggaagat
ggccgcaccctgtcagactacaacatccagaaagagtccaccctgcacttagtccttcgc
ctcagaggtgggatgcagatctttgtgaagaccctgacaggcaaaaccatcaccctggag
gtcgagcccagtgacaccattgagaatgtcaaggcaaagatccaggacaaggagggcatc
ccccctgaccagcagaggctgatctttgcaggcaagcagctggaagatggccgcaccctg
tcagactacaacatccagaaagagtccaccctgcacctggtccttcgcctcagaggtggg
atgcagatctttgtgaagaccctgacaggcaagaccatcaccctggaggtcgagcccagt
gacaccatagagaatgtcaaggcaaagatccaggacaaggagggcatcccccctgaccag
cagaggctgatctttgcaggcaagcagctggaagatggccgcaccctgtcagactacaac
atccagaaagagtccaccctgcacctggtccttcgcctcagaggtggcatgcagatcttt
gtgaagaccctgacaggcaagaccatcaccctggaggtcgagcccagtgacaccatagag
aatgtcaaggcaaagatccaggacaaggagggcatcccccctgaccagcagaggctgatc
tttgcaggcaagcagctggaagatggccgcaccctgtcagactacaacatccagaaagag
tccaccctgcacctggtccttcgcctcagaggtgggatgcagatctttgtgaagaccctg
acaggcaagaccatcaccctggaggtcgagcccagtgacaccatagagaatgtcaaggca
aagatccaggacaaggagggcatcccccctgaccagcagaggctgatctttgcaggcaag
cagctggaagatggccgcaccctgtcagactacaacatccagaaagagtccaccctgcac
ctggtccttcgcctcagaggtggcatgcagatctttgtgaagaccctgacaggcaagacc
atcaccctggaggtcgagcccagtgacaccatagagaatgtcaaggcaaagatccaggac
aaggagggcatcccccctgaccagcagaggctgatctttgcaggcaagcagctggaagat
ggccgcaccctgtcagactacaacatccagaaagagtccaccctgcacctggtccttcgc
ctcagaggtggcatgcagatctttgtgaagaccctgacaggcaagaccatcaccctggac
gtcgagcccagtgttaccaccaagaaggtcaaacaggaagacagacgtaccttcctcacc
acagtatctaaaaagagccctccttgtgcttgttcttgggtgtga

DBGET integrated database retrieval system