KEGG   Mus musculus (house mouse): 22209
Entry
22209             CDS       T01002                                 
Symbol
Ube2a, HHR6A, HR6A, Mhr6a
Name
(RefSeq) ubiquitin-conjugating enzyme E2A
  KO
K10573  ubiquitin-conjugating enzyme E2 A [EC:2.3.2.23]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    22209 (Ube2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    22209 (Ube2a)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    22209 (Ube2a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     22209 (Ube2a)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   22209 (Ube2a)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    22209 (Ube2a)
SSDB
Motif
Pfam: UQ_con RWD UEV Prok-E2_B
Other DBs
NCBI-GeneID: 22209
NCBI-ProteinID: NP_062642
MGI: 102959
Ensembl: ENSMUSG00000016308
UniProt: Q9Z255 Q3UCS1
Position
X:36137948..36147875
AA seq 152 aa
MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFT
EEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS
PANSQAAQLYQENKREYEKRVSAIVEQSWRDC
NT seq 459 nt   +upstreamnt  +downstreamnt
atgtcgaccccggcccggcgccgcctcatgagggacttcaagaggttacaggaagatcct
ccggccggagtgagcggggctccgtcggagaacaacataatggtttggaatgcggtcatt
tttgggcccgaagggaccccgtttgaggatggaacatttaagcttacaattgaattcact
gaagagtatcctaataagccacctactgttagatttgtctctaagatgttccatcctaac
gtctatgcagatggtagtatatgtctggatatacttcagaaccgttggagtccaacctat
gatgtgtcttccattttaacgtccatacagtctctattggatgaacctaatcccaatagt
ccagcaaacagccaggctgcccagctgtaccaggagaacaagcgggaatatgaaaagcgt
gtttctgcaatagtagaacaaagctggcgcgactgttga

DBGET integrated database retrieval system