KEGG   Mus musculus (mouse): 22213
Entry
22213             CDS       T01002                                 

Gene name
Ube2g2, 1110003O05Rik, D10Xrf36, D10Xrf369, UBC7, Ubc7p
Definition
(RefSeq) ubiquitin-conjugating enzyme E2G 2
  KO
K04555  ubiquitin-conjugating enzyme E2 G2 [EC:2.3.2.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
mmu05012  Parkinson disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    22213 (Ube2g2)
   04120 Ubiquitin mediated proteolysis
    22213 (Ube2g2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    22213 (Ube2g2)
   05022 Pathways of neurodegeneration - multiple diseases
    22213 (Ube2g2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    22213 (Ube2g2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     22213 (Ube2g2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   22213 (Ube2g2)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 22213
NCBI-ProteinID: NP_062777
MGI: 1343188
Ensembl: ENSMUSG00000009293
Vega: OTTMUSG00000038229
UniProt: P60605 Q3U431
Structure
PDB: 
3FSH

Position
10 C1; 10 39.72 cM
AA seq 165 aa
MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSF
PLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKIL
LSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL
NT seq 498 nt   +upstreamnt  +downstreamnt
atggcggggacggcgttgaagaggctgatggccgagtataagcaattaaccctgaatcct
ccagaaggaatcgtggcaggccccatgaatgaagagaatttttttgaatgggaggcattg
atcatgggccctgaagacacttgttttgagtttggtgtttttcccgccatcctgagtttc
ccacttgactaccccttgagccctccgaagatgagattcacctgtgagatgttccatccc
aacatctatcctgatggcagagtctgcatctccatcctgcatgctccaggtgatgatccc
atgggttatgagagcagtgccgagcggtggagcccagtgcagagtgtggagaagatcctg
ctttctgttgtgagcatgctggcagagcccaacgatgagagtggagcaaacgtagatgct
tccaagatgtggcgggatgaccgggagcagttctacaagatcgccaagcagattgtccag
aagtctctggggctctga

KEGG   Mus musculus (mouse): 67128
Entry
67128             CDS       T01002                                 

Gene name
Ube2g1, 2700059C12Rik, AI256795, AU014992, AW552068, D130023C12Rik
Definition
(RefSeq) ubiquitin-conjugating enzyme E2G 1
  KO
K10575  ubiquitin-conjugating enzyme E2 G1 [EC:2.3.2.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
mmu05012  Parkinson disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    67128 (Ube2g1)
   04120 Ubiquitin mediated proteolysis
    67128 (Ube2g1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    67128 (Ube2g1)
   05022 Pathways of neurodegeneration - multiple diseases
    67128 (Ube2g1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    67128 (Ube2g1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     67128 (Ube2g1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   67128 (Ube2g1)
SSDB
Motif
Pfam: UQ_con RWD
Other DBs
NCBI-GeneID: 67128
NCBI-ProteinID: NP_080261
MGI: 1914378
Ensembl: ENSMUSG00000020794
Vega: OTTMUSG00000006111
UniProt: P62254 Q5F239
Position
11; 11 B4
AA seq 170 aa
MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLT
FPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETI
MISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
NT seq 513 nt   +upstreamnt  +downstreamnt
atgacggagctgcagtcggcgctgctactgcgaagacagctggcagaactcaacaaaaat
ccagtggaaggcttttcagcaggtttaatagacgacaatgatctctatcgttgggaagtc
cttattattggtcctccagatacactttatgaaggtggtgtttttaaggctcatctcact
ttcccaaaagattatcccctccggcctcctaaaatgaaattcattacagagatttggcac
ccaaatgttgataaaaatggtgatgtttgcatttctattcttcatgagcctggggaggat
aaatatggttatgagaagccagaggaacgctggttacctatccatactgtggaaaccatc
atgattagtgtcatttctatgctggcagatcctaatggagactcacctgcaaatgtagat
gctgcgaaagaatggagggaagacagaaacggagaatttaaaaggaaagttgcccgctgt
gtaagaaaaagccaagaaactgcttttgagtga

DBGET integrated database retrieval system