KEGG   Mus musculus (mouse): 22215
Entry
22215             CDS       T01002                                 

Symbol
Ube3a, 4732496B02, 5830462N02Rik, A130086L21Rik, Hpv, Hpve6a
Name
(RefSeq) ubiquitin protein ligase E3A
  KO
K10587  ubiquitin-protein ligase E3 A [EC:2.3.2.26]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu05165  Human papillomavirus infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    22215 (Ube3a)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    22215 (Ube3a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    22215 (Ube3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    22215 (Ube3a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     22215 (Ube3a)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   22215 (Ube3a)
SSDB
Motif
Pfam: HECT AZUL
Other DBs
NCBI-GeneID: 22215
NCBI-ProteinID: NP_035798
MGI: 105098
Ensembl: ENSMUSG00000025326
Vega: OTTMUSG00000055999
UniProt: O08759 Q5DTH1
Position
7 B5; 7 33.95 cM
AA seq 870 aa
MATACKRSPGESQSEDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLR
MDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGASNNSEIKMNKKEGKDFKDV
IYLTEEKVYEIYEFCRESEDYSPLIRVIGRIFSSAEALVLSFRKVKQHTKEELKSLQEKD
EDKDEDEKEKAACSAAAMEEDSEASSSRMGDSSQGDNNVQKLGPDDVTVDIDAIRRVYSS
LLANEKLETAFLNALVYLSPNVECDLTYHNVYTRDPNYLNLFIIVMENSNLHSPEYLEMA
LPLFCKAMCKLPLEAQGKLIRLWSKYSADQIRRMMETFQQLITYKVISNEFNSRNLVNDD
DAIVAASKCLKMVYYANVVGGDVDTNHNEEDDEEPIPESSELTLQELLGDERRNKKGPRV
DPLETELGVKTLDCRKPLISFEEFINEPLNDVLEMDKDYTFFKVETENKFSFMTCPFILN
AVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKVRRDHIIDDALVRLEMIAM
ENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDEATKLFWFNPSS
FETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDL
LEYEGSVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKS
VEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRESV
VIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFN
VLLLPEYSSKEKLKERLLKAITYAKGFGML
NT seq 2613 nt   +upstreamnt  +downstreamnt
atggccacagcttgtaaaagatcaccaggagaatcccagtctgaggacattgaagctagc
cgaatgaagcgagcagctgcaaagcatctaatagaacgctactaccatcagttaactgag
ggctgtggaaatgaggcctgcacgaatgagttttgtgcttcctgtccaacttttcttcgt
atggataacaatgcagcagctattaaagcccttgagctttataaaattaatgcaaaactc
tgtgatcctcatccctccaagaaaggagcaagctcagcttaccttgagaactcaaaaggt
gcatctaacaactcagagataaaaatgaacaagaaggaaggaaaagattttaaagatgtg
atttacctaactgaagagaaagtatatgaaatttatgaattttgtagagagagtgaggat
tattcccctttaattcgtgtaattggaagaatattttctagtgctgaggcactggttctg
agctttcggaaagtcaaacagcacacaaaggaggaattgaaatctcttcaagaaaaggat
gaagacaaggatgaagatgaaaaggaaaaagctgcatgttctgctgctgctatggaagaa
gactcagaagcatcttcttcaaggatgggtgatagttcacagggagacaacaatgtacaa
aaattaggtcctgatgatgtgactgtggatattgatgctattagaagggtctacagcagt
ttgctcgctaatgaaaaattagaaactgccttcctgaatgcacttgtatatctgtcacct
aacgtggaatgtgatttgacatatcataatgtgtatactcgagatcctaattatctcaat
ttgttcattattgtaatggagaatagtaatctccacagtcctgaatatctggaaatggcg
ttgccattattttgcaaagctatgtgtaagctaccccttgaagctcaaggaaaactgatt
aggctgtggtctaaatacagtgctgaccagattcggagaatgatggaaacatttcagcaa
cttattacctacaaagtcataagcaatgaatttaatagccgaaatctagtgaatgatgat
gatgccattgttgctgcttcaaagtgtttgaaaatggtttactatgcaaatgtagtggga
ggggatgtggacacaaatcataatgaggaagatgatgaagaacccatacctgagtccagc
gaattaacacttcaggagcttctgggagatgaaagaagaaataagaaaggtcctcgagtg
gatccactagaaaccgaacttggcgttaaaactctagactgtcgaaaaccacttatctcc
tttgaagaattcattaatgaaccactgaatgatgttctagaaatggacaaagattatacc
tttttcaaagttgaaacagagaacaaattctcttttatgacatgtccctttatattgaat
gctgtcacaaagaatctgggattatattatgacaatagaattcgcatgtacagtgaaaga
agaatcactgttctttacagcctagttcaaggacagcagttgaatccgtatttgagactc
aaagtcagacgtgaccatattatagatgatgcactggtccggctagagatgattgctatg
gaaaatcctgcagacttgaagaagcagttgtatgtggaatttgaaggagaacaaggagta
gatgagggaggcgtttccaaagagttttttcagttggttgtggaggaaatttttaatcca
gatattggtatgttcacatatgatgaagctacgaaattattttggtttaatccatcttct
tttgaaactgagggtcagtttactctgattggcatagtcctgggtctggctatttacaat
aattgtatactggatgtccattttcccatggttgtatacaggaagctaatggggaaaaaa
ggaacctttcgtgacttgggagactctcacccagttttatatcagagtttaaaggattta
ttggaatatgaagggagtgtggaagatgatatgatgatcactttccagatatcacagaca
gatctttttggtaacccaatgatgtatgatctaaaagaaaatggtgataaaattccaatt
acaaatgaaaacaggaaggaatttgtcaatctctattcagactacattctcaataaatct
gtagaaaaacaattcaaggcatttcgcagaggttttcatatggtgactaatgaatcgccc
ttaaaatacttattcagaccagaagaaattgaattgcttatatgtggaagccggaatcta
gatttccaggcactagaagaaactacagagtatgacggtggctatacgagggaatctgtt
gtgattagggagttctgggaaattgttcattcgtttacagatgaacagaaaagactcttt
ctgcagtttacaacaggcacagacagagcacctgttggaggactaggaaaattgaagatg
attatagccaaaaatggcccagacacagaaaggttacctacatctcatacttgctttaat
gtccttttacttccggaatattcaagcaaagaaaaacttaaagagagattgttgaaggcc
atcacatatgccaaaggatttggcatgctgtaa

DBGET integrated database retrieval system