KEGG   Mus musculus (mouse): 22217Help
Entry
22217             CDS       T01002                                 

Gene name
Usp12, Ubh1
Definition
(RefSeq) ubiquitin specific peptidase 12
  KO
K11842  ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     22217 (Usp12)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   22217 (Usp12)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    22217 (Usp12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 Peptidase_C98 NapB CEBP_ZZ
Motif
Other DBs
NCBI-GeneID: 22217
NCBI-ProteinID: NP_035799
MGI: 1270128
Ensembl: ENSMUSG00000029640
Vega: OTTMUSG00000024588
UniProt: Q9D9M2
Position
5; 5 G3
AA seq 370 aa AA seqDB search
MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFC
RPFREKVLAYKSQPRKKENLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNY
MQQDAHEFLNYLLNTIADILQEERKQEKQNGRLRNGDVDNEDNNSTPDPTWVHEIFQGTL
TNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQ
EAHKRMKVKKLPLILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMY
DLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSES
GYILFYQSRD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctaatgacagtctccaaattcgcctccatctgtaccatgggcgccaatgcc
tcggcattagagaaagagattggtccagaacagtttccggtcaacgagcactattttgga
ttagtcaattttgggaatacctgctactgcaactcagttcttcaagcactttatttttgt
cgtccatttcgggaaaaagttctagcatacaaaagtcagcccagaaaaaaggagaacctt
ctcacctgcctggcagacctcttccacagcatagccacccagaagaagaaggtcggcgtg
atcccgcccaagaagttcatcacaaggttgcggaaagaaaacgagctgtttgacaactac
atgcaacaagatgcccatgaattcttaaattacctactcaatacaattgctgatattcta
caagaagaaagaaaacaggagaagcaaaatggccgattacggaacggagacgtggacaac
gaggataacaacagcacaccagacccaacctgggtccacgagatctttcagggaacatta
actaatgaaaccaggtgtcttacttgtgaaactataagcagcaaagatgaagatttttta
gacctttctgttgacgtggaacaaaacacatcaattactcactgcttaagagggttcagt
aacacagaaactctgtgcagtgaatataagtactactgtgaagagtgccggagcaagcag
gaagcacacaagcggatgaaggttaagaaactgcccctgatcctggctctgcacctgaag
aggtttaagtatatggaccagcttcaccggtacacgaagctttcttatcgcgtggtcttt
cctttagagctccgtctgttcaacacgtcaggagatgcgaccaaccctgacagaatgtat
gacctggtcgccgttgtggttcactgtggaagtggtcccaaccgaggccattatattgca
atagttaagagtcatgatttctggctgttgtttgatgatgacattgtagaaaaaatcgat
gcccaagctattgaagaattctacggattgacatctgacatctccaagaactcggagtct
ggctacatccttttctatcagtctcgggactga

DBGET integrated database retrieval system