KEGG   Mus musculus (mouse): 22218Help
Entry
22218             CDS       T01002                                 

Gene name
Sumo1, GMP1, PIC1, SENTRIN, SMT3, SMT3H3, SMTP3, SUMO-1, Smt3C, Ubl1
Definition
(RefSeq) small ubiquitin-like modifier 1
  KO
K12160  small ubiquitin-related modifier
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    22218 (Sumo1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    22218 (Sumo1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    22218 (Sumo1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    22218 (Sumo1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    22218 (Sumo1)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   22218 (Sumo1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    22218 (Sumo1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    22218 (Sumo1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad60-SLD ubiquitin
Motif
Other DBs
NCBI-GeneID: 22218
NCBI-ProteinID: NP_033486
MGI: 1197010
Ensembl: ENSMUSG00000026021
Vega: OTTMUSG00000022159
UniProt: P63166
Position
1; 1 C2
AA seq 101 aa AA seqDB search
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN
SLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccaggaggcaaaaccttcaactgaggacttaggcgataagaaggaaggagaa
tacattaaactcaaagttattggacaggatagcagtgagatacatttcaaagtgaaaatg
acaacacatctcaagaaactcaaagaatcatactgtcaaagacagggagttccaatgaat
tcactcaggtttctctttgaaggtcagagaattgctgataatcatactccgaaagaactg
ggaatggaggaagaagatgtgattgaagtttatcaggaacaaacggggggtcactcgacg
gtttag

DBGET integrated database retrieval system