KEGG   Mus musculus (mouse): 22222Help
Entry
22222             CDS       T01002                                 

Gene name
Ubr1, AI504731
Definition
(RefSeq) ubiquitin protein ligase E3 component n-recognin 1
  KO
K10625  E3 ubiquitin-protein ligase UBR1 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    22222 (Ubr1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     22222 (Ubr1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   UBR box proteins
    22222 (Ubr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-UBR ClpS
Motif
Other DBs
NCBI-GeneID: 22222
NCBI-ProteinID: NP_033487
MGI: 1277977
Ensembl: ENSMUSG00000027272
Vega: OTTMUSG00000015780
UniProt: O70481
Position
2 E5; 2 60.37 cM
AA seq 1757 aa AA seqDB search
MADEEMDGAERMDVSPEPPLAPQRPASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLE
KQEESVQMSILTPLEWYLFGEDPDICLEKLKHSGAFQLCGKVFKSGETTYSCRDCAIDPT
CVLCMDCFQSSVHKNHRYKMHTSTGGGFCDCGDTEAWKTGPFCVDHEPGRAGTTKESLHC
PLNEEVIAQARRIFPSVIKYIVEMTIWEEEKELPPELQIREKNERYYCVLFNDEHHSYDH
VIYSLQRALDCELAEAQLHTTAIDKEGRRAVKAGVYATCQEAKEDIKSHSENVSQHPLHV
EVLHSVVMAHQKFALRLGSWMNKIMSYSSDFRQIFCQACLVEEPGSENPCLISRLMLWDA
KLYKGARKILHELIFSSFFMEMEYKKLFAMEFVKYYKQLQKEYISDDHERSISITALSVQ
MLTVPTLARHLIEEQNVISVITETLLEVLPEYLDRNNKFNFQGYSQDKLGRVYAVICDLK
YILISKPVIWTERLRAQFLEGFRSFLKILTCMQGMEEIRRQVGQHIEVDPDWEAAIAIQM
QLKNILLMFQEWCACDEDLLLVAYKECHKAVMRCSTNFMSSTKTVVQLCGHSLETKSYKV
SEDLVSIHLPLSRTLAGLHVRLSRLGAISRLHEFVPFDGFQVEVLVEYPLRCLVLVAQVV
AEMWRRNGLSLISQVFYYQDVKCREEMYDKDIIMLQIGASIMDPNKFLLLVLQRYELTDA
FNKTISTKDQDLIKQYNTLIEEMLQVLIYIVGERYVPGVGNVTREEVIMREITHLLCIEP
MPHSAIARNLPENENNETGLENVINKVATFKKPGVSGHGVYELKDESLKDFNMYFYHYSK
TQHSKAEHMQKKRRKQENKDEALPPPPPPEFCPAFSKVVNLLSCDVMMYILRTIFERAVD
MESNLWTEGMLQMAFHILALGLLEEKQQLQKAPEEEVAFDFYHKASRLGSSAMNAQNIQM
LLEKLKGIPQLESQKDMITWILQMFDTVKRLREKSCLVVATTSGLECVKSEEITHDKEKA
ERKRKAEAARLHRQKIMAQMSALQKNFIETHKLMYDNTSEVTGKEDSIMEEESTSAVSEA
SRIALGPKRGPAVTEKEVLTCILCQEEQEVKLENNAMVLSACVQKSTALTQHRGKPVDHL
GETLDPLFMDPDLAHGTYTGSCGHVMHAVCWQKYFEAVQLSSQQRIHVDLFDLESGEYLC
PLCKSLCNTVIPIIPLQPQKINSENAEALAQLLTLARWIQTVLARISGYNIKHAKGEAPA
VPVLFNQGMGDSTFEFHSILSFGVQSSVKYSNSIKEMVILFATTIYRIGLKVPPDELDPR
VPMMTWSTCAFTIQAIENLLGDEGKPLFGALQNRQHNGLKALMQFAVAQRTTCPQVLIHK
HLARLLSVILPNLQSENTPGLLSVDLFHVLVGAVLAFPSLYWDDTVDLQPSPLSSSYNHL
YLFHLITMAHMLQILLTTDTDLSSGPPLAEGEEDSEEARCASAFFVEVSQHTDGLAGCGA
PGWYLWLSLRNGITPYLRCAALLFHYLLGVAPPEELFANSAEGEFSALCSYLSLPTNLFL
LFQEYWDTIRPLLQRWCGDPALLKSLKQKSAVVRYPRKRNSLIELPEDYSCLLNQASHFR
CPRSADDERKHPVLCLFCGAILCSQNICCQEIVNGEEVGACVFHALHCGAGVCIFLKIRE
CRVVLVEGKARGCAYPAPYLDEYGETDPGLKRGNPLHLSRERYRKLHLVWQQHCIIEEIA
RSQETNQMLFGFNWQLL
NT seq 5274 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaagagatggacggcgccgagaggatggacgtcagcccggagcctcccctg
gccccgcagcggccggcatcgtggtgggatcagcaagttgatttctatactgctttctta
catcatttggcacaattagtgccagaaatttattttgctgagatggacccagatttggaa
aagcaagaagagagtgtacagatgtcaatactcactcctttggagtggtacttatttgga
gaggatccggatatttgcttagagaaattaaaacacagtggagcgttccagttgtgtggg
aaggttttcaaaagtggagaaacaacatattcctgtagggattgtgcaattgatccaacg
tgtgtgctctgtatggactgcttccaaagtagtgttcataaaaaccatcgttacaagatg
catacttctactggaggaggcttctgtgactgtggagacacagaagcgtggaaaactggc
cctttttgtgtggatcacgagcctggaagagcaggtactacaaaagagagcttacattgc
ccattgaatgaagaggtgattgctcaagccaggagaatattcccttcggtgataaaatac
attgtagaaatgactatatgggaagaagaaaaggaattgcctcctgaactgcagataagg
gagaaaaatgaacgatactattgtgtccttttcaacgatgagcaccattcgtatgatcat
gtgatctacagtctgcagagagctctagattgcgagcttgcagaggcacagctgcacacg
actgccatcgacaaagagggtcgccgggctgtcaaagcaggtgtgtatgccacttgccag
gaagcaaaggaggatataaagagtcactcagagaacgtctctcagcaccccctccatgtg
gaagtgctgcactccgtggttatggctcaccagaaattcgctctgcgccttggctcctgg
atgaacaaaattatgagctattcaagtgactttagacagatattttgccaggcctgcctc
gtagaagaacctggctctgaaaatccctgtcttataagcagactaatgctttgggatgca
aaactttataaaggtgcccgtaagatccttcatgaattgatctttagtagtttttttatg
gagatggaatacaaaaaactctttgctatggaatttgtgaagtattataaacagctgcag
aaagagtacatcagcgacgaccacgagagaagcatctccataaccgccctgtccgtgcag
atgctcaccgtcccgaccttggcccggcatcttattgaagagcagaatgttatttctgtc
attactgaaacgctgctagaagttttacctgaatacttggacaggaacaataaattcaac
ttccagggttatagccaggacaaactgggaagagtctacgcagttatatgtgacctaaag
tatatcctgattagcaagcctgtcatatggacagaacgattaagagcgcagttcctggaa
ggtttccggtcttttctgaagattcttacctgtatgcagggaatggaagaaatcagaaga
caagttggacaacacattgaagtggaccctgactgggaggctgccatcgctatacagatg
caactaaagaatattttgctcatgttccaagagtggtgtgcttgtgatgaagatctctta
ctggtggcttataaagaatgtcacaaagctgtaatgaggtgcagtacaaatttcatgtcc
agtaccaagacagtagtgcaattgtgcggtcatagtctggaaaccaaatcctacaaagtg
tctgaggaccttgtaagcatacacctgccactctctagaacacttgctggtcttcatgta
cgtttaagcagactaggtgctatttcaagactgcatgaatttgtgccttttgacggcttt
caagtagaggtcctggtggagtacccgctgcgctgcctggtcctggtggctcaggttgtt
gctgagatgtggcgaagaaacgggctctcactcatcagccaggttttctattatcaagat
gttaaatgcagggaggaaatgtacgataaagatatcatcatgcttcagattggagcatct
ataatggatcccaacaagttcttgttactggtacttcagagatatgaacttactgatgct
tttaacaagaccatatccacaaaagaccaggatttgattaaacagtataatacattaata
gaagaaatgcttcaggtcctcatctatattgtgggagaacgttatgtacctggagtggga
aatgttaccagagaggaggttataatgagagagattactcacttactttgcattgagccc
atgccacatagtgccatcgccagaaacctacctgagaacgaaaataatgaaactggctta
gagaatgtcataaacaaagtggccacatttaagaaaccaggtgtgtcgggccatggagtt
tatgaattgaaagatgaatcactgaaagacttcaatatgtacttttaccattattctaaa
acacagcatagcaaggctgaacatatgcagaagaaaaggagaaaacaagaaaataaagat
gaagcattgccgccgccacctcctccggagttctgccctgctttcagcaaagtagtcaac
ctgctcagctgtgatgttatgatgtacatcctcaggaccatctttgagcgggcagtggac
atggagtctaatctgtggacagaagggatgctgcagatggcgttccatatattggcactg
ggcttgctggaagagaagcagcagcttcagaaagctcctgaagaggaagtggcttttgac
ttttaccataaggcttcaagattgggaagttcagccatgaatgctcagaatatacaaatg
ctcttggaaaaactcaaaggaatcccccaattagaaagccagaaggacatgataacatgg
atactccagatgtttgacacagtgaagcgattaagagaaaaatcttgtttagttgtggca
accacttcaggactggagtgcgttaagagtgaggagattactcatgataaagaaaaggca
gaaaggaagagaaaagctgaggccgctaggcttcatcgccagaagatcatggcccagatg
tctgccttacagaaaaacttcattgaaacccacaaactcatgtatgataatacgtcagaa
gtaacagggaaggaagactccattatggaggaagagagcacctcagcagtcagtgaggcc
tctagaattgctctgggccctaaacggggcccggctgttactgaaaaggaggtgctgacg
tgcatcctctgccaagaagaacaagaggtgaaactagaaaataacgccatggtattgtca
gcatgtgtgcagaaatccaccgccctaacccagcacagagggaagcctgtggaccactta
ggggaaacactggaccctcttttcatggatccagacttggcacatggaacttatacagga
agctgtggtcatgtaatgcatgcagtgtgctggcagaagtattttgaagctgtgcagctg
agctcgcagcagcgcattcacgtagacctgtttgacctggagagcggcgagtacctatgc
ccgctctgcaagtctctctgcaatactgtcatccccatcatccctttgcagccgcagaag
atcaacagtgagaatgcggaggctcttgctcaacttttgaccttggcccggtggatacag
actgtccttgccagaatatcgggttataatataaagcatgctaaaggagaagccccagca
gttcctgtcttgtttaatcaaggaatgggggattcgacttttgagtttcattccatcctg
agttttggagttcagtcttcggtgaaatattcaaatagtatcaaggaaatggtcattctc
ttcgccacaacaatttacagaattggcctgaaagtgcctcctgatgaactagacccacga
gtgcccatgatgacctggagcacgtgtgcgttcaccatccaggcaatcgaaaacctgttg
ggagatgaaggaaaacctctatttggagcacttcaaaatagacagcataacggtctgaag
gcgctaatgcagtttgcagttgcacagaggactacctgccctcaggtcctgatacacaaa
catctggctcggctcctgtcagttattcttcctaacctgcaatcagaaaatacaccaggc
cttctgtccgtggatctcttccatgttctggtcggcgcagtcttagcgttcccatccttg
tattgggatgacaccgtggatctgcagccgtcaccacttagttcttcatataaccacctc
tatctcttccatctgatcaccatggcgcacatgcttcagatactccttacaacagataca
gatctgtcttcagggccgccgcttgctgagggtgaagaggatagtgaggaggctcgctgt
gcatctgctttctttgtggaagtgtcgcagcacacagacggcctcgctgggtgcggtgct
cccggctggtacctgtggctctccctgaggaacggcatcaccccttacctccgctgtgct
gcactgcttttccactatttacttggagtagctccgcctgaagaactgtttgccaattct
gctgaaggagaattcagtgcactctgtagctatctatctttacccacaaatttgttcctg
cttttccaggaatattgggataccataaggcccttactacagaggtggtgtggagatcct
gccttactcaagtctttgaagcagaaaagtgctgtggtcaggtaccctagaaaaagaaat
agtttgatagagcttcctgaggactacagctgtcttctaaatcaggcttctcactttagg
tgtccacggtctgcagatgatgagcgaaagcatcctgtcctctgtcttttctgtggggcc
atcctgtgttctcagaacatctgttgccaagaaatagtgaatggggaagaggttggagcg
tgcgtttttcatgcgcttcattgtggtgctggagtctgcattttcttaaaaatccgagaa
tgcagggtggtcctggtggaaggaaaagccagaggctgtgcctacccagccccttacttg
gatgaatatggagaaacagacccagggctaaagagaggaaacccacttcatttatctcgg
gagcggtatcggaagctgcatttggtctggcaacagcactgcattatagaagagattgct
cggagccaggagactaatcagatgctatttggattcaactggcagttactctga

DBGET integrated database retrieval system