KEGG   Mus musculus (house mouse): 22223
Entry
22223             CDS       T01002                                 
Symbol
Uchl1, AW822034, C88048, PGP_9.5, PGP9.5, R75593, UCH-L1, UCHL-1, gad
Name
(RefSeq) ubiquitin carboxy-terminal hydrolase L1
  KO
K05611  ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05012  Parkinson disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    22223 (Uchl1)
   05022 Pathways of neurodegeneration - multiple diseases
    22223 (Uchl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    22223 (Uchl1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    22223 (Uchl1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     22223 (Uchl1)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   22223 (Uchl1)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    22223 (Uchl1)
SSDB
Motif
Pfam: Peptidase_C12
Other DBs
NCBI-GeneID: 22223
NCBI-ProteinID: NP_035800
MGI: 103149
Ensembl: ENSMUSG00000029223
Vega: OTTMUSG00000042268
UniProt: Q9R0P9
Position
5:66833464..66844577
AA seq 223 aa
MQLKPMEINPEMLNKVLAKLGVAGQWRFADVLGLEEETLGSVPSPACALLLLFPLTAQHE
NFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSE
TEKLSPEDRAKCFEKNEAIQAAHDSVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMP
FPVNHGASSEDSLLQDAAKVCREFTEREQGEVRFSAVALCKAA
NT seq 672 nt   +upstreamnt  +downstreamnt
atgcagctgaagccgatggagattaaccccgagatgctgaacaaagtgttggccaagctg
ggggtcgccggccagtggcgcttcgccgacgtgctagggctggaggaggagactctgggc
tcagtgccatcccctgcctgcgccctgctgctcctgtttcccctcacggcccagcatgaa
aacttcaggaaaaagcaaattgaggaactgaagggacaggaagttagccctaaagtttac
ttcatgaagcagaccatcggaaactcctgtggtaccatcgggttgatccacgcagtggcc
aacaaccaagacaagctggaatttgaggatggatccgtcctgaaacagtttctgtctgaa
acggagaagctgtcccccgaagatagagccaagtgtttcgagaagaacgaggccatccag
gcggcccatgactccgtggcccaggagggccagtgtcgggtagatgacaaagtgaatttc
cattttattctgttcaacaacgtggacggccatctgtacgagctcgatgggcgaatgccc
tttccagtgaaccatggcgccagctcagaggactctctgctgcaggatgctgccaaggtc
tgcagagaattcactgagcgcgagcagggggaggtccgcttctctgccgtggctctctgc
aaagcagcttaa

DBGET integrated database retrieval system