KEGG   Mus musculus (mouse): 22225
Entry
22225             CDS       T01002                                 

Gene name
Usp5, AA407472, ISOT, ISOT-1, Ucht
Definition
(RefSeq) ubiquitin specific peptidase 5 (isopeptidase T)
  KO
K11836  ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    22225 (Usp5)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    22225 (Usp5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22225 (Usp5)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     22225 (Usp5)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   22225 (Usp5)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    22225 (Usp5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   22225 (Usp5)
SSDB
Motif
Pfam: UCH zf-UBP_var UBA zf-UBP UCH_1 UBA_4 UBA_3
Other DBs
NCBI-GeneID: 22225
NCBI-ProteinID: NP_038728
MGI: 1347343
Ensembl: ENSMUSG00000038429
Vega: OTTMUSG00000027216
UniProt: P56399
Position
6 F2; 6 59.17 cM
AA seq 858 aa
MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVER
HFNKTGQRVYLHLRRTRRPKEEDTSAGTGDPPRKKPTRLAIGVEGGFDLTEDKFEFDEDV
KIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
FNLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRET
GYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLKMQKTDKTMTELEIDM
NQRIGEWELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEK
IFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPALESGDGEQVPEQKEVQDGIAPRMFKAL
IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYT
QRVDYIMQLPVPMDAALNKEELLEYEEKKRQAEEEKVPLPELVRAQVPFSSCLEAYGAPE
QVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDIS
QLRGTGLQPGEEELPDIAPPLVTPDEPKGSLGFYGNEDEDSFCSPHFSSPTSPMLDESVI
IQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSSGPGSTSAAA
DPPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGRSA
AESISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCAS
EKPPKDLGYIYFYQRVVS
NT seq 2577 nt   +upstreamnt  +downstreamnt
atggcggagctgagtgaagaggcgctgctgtcagtgttaccgacgatccgtgtccccaag
gcgggagaccgggtccataaagacgagtgcgctttctctttcgacacgccggagtctgag
ggtggcctctatatctgcatgaacacattcctgggattcgggaagcagtatgtggagaga
cacttcaacaagacaggccagcgtgtctacctgcacctccggaggacccggcgaccgaaa
gaagaggacaccagtgcaggcactggagacccacctcggaagaagcccacccggctggcc
attggtgttgaaggagggtttgacctcaccgaggacaagtttgaatttgacgaggatgtg
aagattgtcattttgcccgattacctggagatcgctcgggatgggttgggggggcttcct
gacattgtcagagatcgggtgaccagtgctgtggaagccctactttctgctgactcagcc
tctcgaaagcaggaggtccaggcttgggatggggaagtccgtcaggtgtccaagcatgcc
ttcaacctcaagcagttggacaaccctgctcggatccctccctgtggctggaagtgctcc
aagtgcgacatgcgcgagaacctgtggctcaacctgacagacggctccatcctctgtgga
cggcgctacttcgatggcagtgggggcaacaaccatgctgtggagcactacagggagact
ggctaccccttagctgttaagctgggcaccatcaccccggatggagctgacgtgtattct
tacgacgaggatgacatggttctggaccccagcctggcagagcacttgtctcactttggc
atcgacatgctgaagatgcagaagacggacaagacgatgactgagctggagatagacatg
aaccagcggattggtgaatgggagttgatccaggagtcaggcgtgccactcaagcctctg
tttgggcctggttacacgggcatccggaacctgggtaacagctgctatctcaactccgtg
gtccaggtgctcttcagcatccctgactttcagaggaagtatgtggataaattggagaag
atcttccagaatgccccaacggaccccacccaagacttcagcacccaggtggccaagctg
gggcatggccttctctctggagaatactctaagccagcactggagtcaggtgatggggag
caggtaccagaacaaaaggaagttcaagatggcattgcccctcgaatgttcaaggccctc
attggcaagggccaccctgagttctccactaatcggcagcaggatgcccaggaattcttc
ctacatcttatcaacatggtggagaggaattgccggagttctgaaaatccaaatgaagtg
ttccgctttttggtggaagaaaagatcaaatgcctggccacagagaaggttaagtacact
cagcgagttgactacatcatgcagttgcctgtacccatggatgcagcccttaacaaagag
gagcttttagagtatgaagagaagaagcggcaagctgaagaggagaaagtgccactgcca
gaactggttcgggcccaggtgcccttcagctcctgcctggaagcctacggggcccctgag
caggtggacgacttctggagtacagctctacaggcgaagtcggtcgctgtcaagaccacg
cgctttgcctccttccccgactacctggtcatccagatcaagaagttcacctttggctta
gactgggtgcccaagaagctggatgtgtccattgagatgccagaggagctcgatatctcc
cagctgaggggcacagggctacagccgggagaggaggagctgcctgacattgccccaccc
ctggtcactccggatgagcccaaaggtagccttggtttctatggcaacgaagacgaagac
tccttctgctcccctcacttctcctctccgacatcacccatgctggacgaatccgtcatc
atacagttggtggaaatgggcttccctatggatgcctgccggaaagctgtgtactatacg
ggaaacagcggggccgaagcagccatgaactgggtcatgtcacacatggatgatccagat
tttgcaaaccccctcatcctgcctggctccagtgggcctggctccacaagtgcagcagct
gaccccccgccggaggactgtgtgaccaccatagtctccatgggcttctccagggaccag
gccctgaaagctctgcgggccacgaacaatagcttagagcgggctgtagactggatcttc
agccacattgatgacctggacgcagaagctgctatggacatctcagagggacgctcagcg
gctgagtccatctccgagtctgtgccagtgggacctaaagtccgggatggtcctggaaag
tatcagctctttgccttcattagtcacatgggcacatctactatgtgtggtcactatgtc
tgccatatcaagaaggaaggcaggtgggtgatctacaatgaccagaaagtgtgtgcctct
gaaaagccacccaaggacctgggctacatctacttctaccagagagtggtcagctaa

DBGET integrated database retrieval system