KEGG   Mus musculus (mouse): 22227Help
Entry
22227             CDS       T01002                                 

Gene name
Ucp1, AI385626, Slc25a7, Ucp
Definition
(RefSeq) uncoupling protein 1 (mitochondrial, proton carrier)
  KO
K08769  solute carrier family 25 (mitochondrial uncoupling protein), member 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04371  Apelin signaling pathway
mmu04714  Thermogenesis
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    22227 (Ucp1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    22227 (Ucp1)
  09159 Environmental adaptation
   04714 Thermogenesis
    22227 (Ucp1)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    22227 (Ucp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    22227 (Ucp1)
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   22227 (Ucp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 22227
NCBI-ProteinID: NP_033489
MGI: 98894
Ensembl: ENSMUSG00000031710
Vega: OTTMUSG00000061515
UniProt: P12242
Position
8 C2; 8 39.65 cM
AA seq 307 aa AA seqDB search
MVNPTTSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLG
TITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDSVQEYFSSGRETPASLGNKISAG
LMTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPN
LMRNVIINCTELVTYDLMKGALVNNKILADDVPCHLLSALVAGFCTTLLASPVDVVKTRF
INSLPGQYPSVPSCAMSMYTKEGPTAFFKGFVASFLRLGSWNVIMFVCFEQLKKELMKSR
QTVDCTT
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacccgacaacttccgaagtgcaacccaccatgggggtcaagatcttctcagcc
ggagtttcagcttgcctggcagatatcatcaccttcccgctggacactgccaaagtccgc
cttcagatccaaggtgaaggccaggcttccagtaccattaggtataaaggtgtcctaggg
accatcaccaccctggcaaaaacagaaggattgccgaaactgtacagcggtctgcctgcg
ggcattcagaggcaaatcagctttgcctcactcaggattggcctctacgactcagtccaa
gagtacttctcttcagggagagaaacacctgcctctctcggaaacaagatctcagccggc
ttaatgactggaggtgtggcagtgttcattgggcagcctacagaggtcgtgaaggtcaga
atgcaagcccagagccatctgcatgggatcaaaccccgctacacggggacctacaatgct
tacagagttatagccaccacagaaagcttgtcaacactttggaaagggacgacccctaat
ctaatgagaaatgtcatcatcaattgtacagagctggtaacatatgacctcatgaagggg
gcccttgtaaacaacaaaatactggcagatgacgtcccctgccatttactgtcagctctt
gttgccgggttttgcaccacactcctggcctctccagtggatgtggtaaaaacaagattc
atcaactctctgccaggacagtacccaagcgtaccaagctgtgcgatgtccatgtacacc
aaggaaggaccgacggcctttttcaaagggtttgtggcttcttttctgcgactcgggtcc
tggaacgtcatcatgtttgtgtgctttgaacagctgaaaaaagagctgatgaagtccaga
cagacagtggattgtaccacataa

DBGET integrated database retrieval system