KEGG   Mus musculus (mouse): 22228
Entry
22228             CDS       T01002                                 

Gene name
Ucp2, Slc25a8, UCP_2, UCPH
Definition
(RefSeq) uncoupling protein 2 (mitochondrial, proton carrier)
  KO
K15103  solute carrier family 25 (mitochondrial uncoupling protein), member 8/9
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    22228 (Ucp2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   22228 (Ucp2)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 22228
NCBI-ProteinID: NP_035801
MGI: 109354
Ensembl: ENSMUSG00000033685
Vega: OTTMUSG00000022804
UniProt: P70406 Q549J5
Structure
PDB: 
2LCK

Position
7 E2; 7 54.36 cM
AA seq 309 aa
MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGLVRTAASAQYR
GVLGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRL
LAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVEAYKTIAREEGIRGLWKGTS
PNVARNAIVNCAELVTYDLIKDTLLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT
RYMNSALGQYHSAGHCALTMLRKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA
AYQSREAPF
NT seq 930 nt   +upstreamnt  +downstreamnt
atggttggtttcaaggccacagatgtgcccccaacagccactgtgaagttcctgggggct
gggacagctgcctgcattgcagatctcatcactttccctctggataccgccaaggtccgg
ctgcagatccaaggggagagtcaagggctagtgcgcaccgcagccagcgcccagtaccgt
ggcgttctgggtaccatcctaaccatggtgcgcactgagggtccacgcagcctctacaat
gggctggtcgccggcctgcagcgccagatgagctttgcctccgtccgcattggcctctac
gactctgtcaaacagttctacaccaagggctcagagcatgcaggcatcgggagccgcctc
ctggcaggtagcaccacaggtgccctggccgtggctgtagcccagcctacagatgtggta
aaggtccgcttccaggctcaggcccgggctggtggtggtcggagataccagagcactgtc
gaagcctacaagaccattgcacgagaggaagggatccggggcctctggaaagggacttct
cccaatgttgcccgtaatgccattgtcaactgtgctgagctggtgacctatgacctcatc
aaagatactctcctgaaagccaacctcatgacagatgacctcccttgccacttcacttct
gccttcggggccggcttctgcaccaccgtcatcgcctcccctgttgatgtggtcaagacg
agatacatgaactctgccttgggccagtaccacagcgcaggtcactgtgcccttaccatg
ctccggaaggagggaccccgcgccttctacaaggggttcatgccttcctttctccgcttg
ggatcctggaacgtagtgatgtttgtcacctatgagcagctcaaaagagccctaatggct
gcctaccaatctcgggaggcacctttctga

DBGET integrated database retrieval system