KEGG   Mus musculus (mouse): 22230
Entry
22230             CDS       T01002                                 

Gene name
Ufd1, Ufd1l
Definition
(RefSeq) ubiquitin recognition factor in ER-associated degradation 1
  KO
K14016  ubiquitin fusion degradation protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    22230 (Ufd1)
SSDB
Motif
Pfam: UFD1 CDC48_2
Other DBs
NCBI-GeneID: 22230
NCBI-ProteinID: NP_035802
MGI: 109353
Ensembl: ENSMUSG00000005262
Vega: OTTMUSG00000036274
UniProt: P70362
Position
16 A3; 16 11.65 cM
AA seq 307 aa
MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLN
ITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVA
TYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAV
SIIECDMNVDFDAPLGYKEPERPVQHEESIEGEADHSGYAGEVGFRAFSGSGNRLDGKKK
GVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKKVEEDEAGGRFIAFSGEGQSL
RKKGRKP
NT seq 924 nt   +upstreamnt  +downstreamnt
atgttttctttcaacatgtttgaccacccgattccccgggtcttccagaaccgcttctcc
acgcagtaccgctgcttctccgtgtccatgctagcagggcctaatgacaggtcagatgtg
gagaaaggagggaagataattatgccaccctcagccctcgatcaactcagccggctcaac
attacctatcctatgctgtttaaattgaccaataagaattcagatcggatgacacactgc
ggtgtactggagtttgttgctgatgaaggcatctgttacctcccccactggatgatgcag
aatttgctgttggaggaagggggcctggttcaggtggaaagtgtcaacctccaagtggcg
acctactctaagttccagcctcagagcccagacttcctggatattaccaaccctaaagcg
gtattagaaaatgcattgagaaacttcgcctgtctgacgactggagatgtgattgctatc
aactacaatgagaagatctatgagctgcgggtgatggagaccaaacctgacaaggctgta
tccattattgaatgtgacatgaatgtggattttgatgctcccttgggatacaaagaacca
gaaagaccagtgcagcatgaggagtcaatagagggagaagctgaccacagtggctatgcc
ggagaggtgggcttccgtgccttctctggttctgggaatagactggatgggaagaaaaaa
ggggttgagcccagtccctccccaatcaagcctggagacatcaaaagaggaattcctaat
tacgaatttaagcttggtaagatcactttcatcagaaattcacgtccattggtcaaaaag
gttgaagaggatgaagctggaggcagattcattgctttctctggagaaggacagtcactg
cgtaagaagggaagaaagccctaa

DBGET integrated database retrieval system