KEGG   Mus musculus (mouse): 22241
Entry
22241             CDS       T01002                                 

Gene name
Ulk1, AU041434, Unc51., Unc51.1, mKIAA0722
Definition
(RefSeq) unc-51 like kinase 1
  KO
K21357  serine/threonine-protein kinase ULK1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    22241 (Ulk1)
   04150 mTOR signaling pathway
    22241 (Ulk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    22241 (Ulk1)
   04137 Mitophagy - animal
    22241 (Ulk1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    22241 (Ulk1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    22241 (Ulk1)
   05014 Amyotrophic lateral sclerosis
    22241 (Ulk1)
   05016 Huntington disease
    22241 (Ulk1)
   05017 Spinocerebellar ataxia
    22241 (Ulk1)
   05022 Pathways of neurodegeneration - multiple diseases
    22241 (Ulk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    22241 (Ulk1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    22241 (Ulk1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    22241 (Ulk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     22241 (Ulk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   22241 (Ulk1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    22241 (Ulk1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    22241 (Ulk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr DUF3543 Kdo RIO1 Pkinase_fungal Kinase-like APH
Other DBs
NCBI-GeneID: 22241
NCBI-ProteinID: NP_033495
MGI: 1270126
Ensembl: ENSMUSG00000029512
Vega: OTTMUSG00000054223
UniProt: O70405 A0A0R4J0B3
Position
5; 5 F
AA seq 1051 aa
MEPGRGGVETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLL
GKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHTMRTLSEDTVRLFLQ
QIAGAMRLLHSKGIIHRDLKPQNILLSNPGGRRANPSNIRVKIADFGFARYLQSNMMAAT
LCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLV
PAIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASTPIKKSPPVPVPSYPSSGS
GSSSSSSSASHLASPPSLGEMPQLQKTLTSPADAAGFLQGSRDSGGSSKDSCDTDDFVMV
PAQFPGDLVAEAASAKPPPDSLLCSGSSLVASAGLESHGRTPSPSPTCSSSPSPSGRPGP
FSSNRYGASVPIPVPTQVHNYQRIEQNLQSPTQQQTARSSAIRRSGSTSPLGFGRASPSP
PSHTDGAMLARKLSLGGGRPYTPSPQVGTIPERPSWSRVPSPQGADVRVGRSPRPGSSVP
EHSPRTTGLGCRLHSAPNLSDFHVVRPKLPKPPTDPLGATFSPPQTSAPQPCPGLQSCRP
LRGSPKLPDFLQRSPLPPILGSPTKAGPSFDFPKTPSSQNLLTLLARQGVVMTPPRNRTL
PDLSEASPFHGQQLGSGLRPAEDTRGPFGRSFSTSRITDLLLKAAFGTQASDSGSTDSLQ
EKPMEIAPSAGFGGTLHPGARGGGASSPAPVVFTVGSPPSGATPPQSTRTRMFSVGSSSS
LGSTGSSSARHLVPGACGEAPELSAPGHCCSLADPLAANLEGAVTFEAPDLPEETLMEQE
HTETLHSLRFTLAFAQQVLEIAALKGSASEAAGGPEYQLQESVVADQISQLSREWGFAEQ
LVLYLKVAELLSSGLQTAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQR
FFLDKQRLLDGIHGVTAERLILSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQH
TLTDQADIENIAKCKLCIERRLSALLSGVYA
NT seq 3156 nt   +upstreamnt  +downstreamnt
atggagccgggccgcggcggcgtcgagaccgtgggcaagttcgagttctctcgcaaggac
ctgattggacacggcgccttcgcggtggtcttcaagggtcgacaccgcgagaagcacgac
ctggaggtggccgtcaaatgcattaacaagaagaaccttgccaagtcccaaacactgctg
ggaaaggaaatcaaaatcctgaaggaactaaagcacgaaaacatcgtggcgctgtatgac
ttccaggaaatggctaattctgtctacctggtcatggagtattgtaatggtggagacctg
gctgactacctgcacactatgcgcacactgagtgaagacactgtcaggcttttcctacag
cagatcgctggcgccatgcggctgctgcacagcaagggcatcatccaccgggacctgaag
ccccaaaacatcctgctgtccaaccctgggggccgccgggccaaccccagcaacatccga
gtcaagattgctgactttggattcgctcggtacctccagagcaacatgatggcggccaca
ctctgtggttctcctatgtacatggctcctgaggtcattatgtcccagcactacgatgga
aaggctgacctgtggagcattggcaccattgtctaccagtgtctgacagggaaggcccct
tttcaggccagcagccctcaggatttgcgcctgttttatgagaagaacaagacactagtt
cctgccatcccccgggagacatcagctcccctgcggcagctgctcctggctctgttgcag
cggaaccacaaggaccgcatggactttgatgaatttttccaccaccctttcttggatgcc
agcacccccatcaagaaatccccacctgtgcctgtgccctcatatccaagctcagggtct
ggcagcagctccagcagcagctctgcctcccacctggcctctccaccgtccctgggggag
atgccacagctacagaagacccttacctccccagccgatgctgctggctttcttcagggc
tcccgggactctggtggcagcagcaaagactcctgtgacacagatgactttgtcatggtc
ccagcccagtttccaggtgatctagttgctgaggcagccagtgccaagcccccacctgat
agcctgctgtgtagtgggagctcattggtggcctctgctggcctagagagccacggccgt
accccctctccctctccgacctgcagcagctctcccagcccctctggccggcctggcccc
ttctccagcaacaggtacggtgcctcggtccccattcctgtccccactcaggtgcacaat
taccagcgcatcgagcaaaacctgcaatcgcccactcaacagcagacagccaggtcctct
gccatccgaaggtcagggagcaccagccccctgggctttggccgggccagcccatcaccc
ccctcccacaccgatggagccatgctggccaggaagctgtcacttggaggtggccgtccc
tacacaccttctccccaagtgggaaccatcccagagcgacccagctggagcagagtgccc
tccccacaaggagctgatgtgcgggttggcaggtcaccacgacccggttcctctgtgcct
gagcactctccaagaaccactgggctgggctgccgcctgcacagtgcccctaacctgtcc
gacttccatgttgtgcgtcccaagctgcctaagcccccaacagacccactgggagccacc
tttagcccaccccagaccagcgcaccccagccatgcccagggctacagtcttgccggcca
ctgcgtggctcacctaagctgcctgacttcctacagcggagtcccctaccccccatccta
ggctctcctaccaaggccgggccctcctttgacttccccaaaacccccagctctcagaat
ttgctgaccctgttggctaggcagggggtagtaatgacaccacctcggaaccgtacactg
cctgacctctccgaggccagtcctttccatggccagcagctgggctctggccttcggccc
gctgaagacacccggggtccctttggacggtccttcagcaccagccgcattacggacctg
ctgcttaaggctgcatttgggactcaggcctctgactcaggcagcacagacagcctacag
gagaaacctatggagattgctccctctgctggctttggagggactctgcatccaggagct
cgtggtggaggggccagcagcccagcacctgtggtatttactgtaggctccccacccagt
ggtgccaccccaccccagagtacccgtaccagaatgttctcagtgggctcttccagctcc
ctgggctctactggctcctcctctgcccgccacttagtgcctggggcctgtggagaggcc
ccggagctttctgccccaggccactgctgtagccttgctgacccccttgctgccaacttg
gagggggctgtgaccttcgaggctcctgacctcccagaggagaccctcatggagcaagag
cacacggaaaccctacacagtctgcgcttcacactagcgtttgcacagcaagttctggag
attgcagccctgaagggaagtgccagtgaggccgccggtggccctgagtaccagctccag
gaaagtgtggtggctgaccagatcagtcagttgagccgagagtggggctttgcagagcaa
ctggttctgtacttgaaggtggctgagctgctgtcctcaggcctacagactgccattgac
cagattcgagctggcaaactctgcctttcatctactgtgaagcaggtggtacgcagacta
aatgagctgtacaaggccagcgtggtatcctgccagggcctcagcttgcgacttcagcgc
ttctttctggacaaacaacggctgctggacgggatccatggtgtcactgcagagcggctc
atcctcagccatgctgtgcaaatggtacaatcagctgcccttgatgagatgttccagcac
cgagagggctgtgtaccgagatatcacaaagccctgctattgctggaggggttgcagcac
actctcacggaccaggcagacattgagaacattgccaaatgcaagctgtgcattgagagg
agactctcggccctgctgagtggtgtctatgcctga

KEGG   Mus musculus (mouse): 29869
Entry
29869             CDS       T01002                                 

Gene name
Ulk2, A830085I22Rik, AU015340, Unc51., Unc51.2, mKIAA0623
Definition
(RefSeq) unc-51 like kinase 2
  KO
K08269  serine/threonine-protein kinase ULK2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04136  Autophagy - other
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    29869 (Ulk2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    29869 (Ulk2)
   04136 Autophagy - other
    29869 (Ulk2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29869 (Ulk2)
   05014 Amyotrophic lateral sclerosis
    29869 (Ulk2)
   05016 Huntington disease
    29869 (Ulk2)
   05017 Spinocerebellar ataxia
    29869 (Ulk2)
   05022 Pathways of neurodegeneration - multiple diseases
    29869 (Ulk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    29869 (Ulk2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    29869 (Ulk2)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    29869 (Ulk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     29869 (Ulk2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   29869 (Ulk2)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   Atg1 complex
    29869 (Ulk2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    29869 (Ulk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr DUF3543 Kdo RIO1 Pkinase_fungal APH Kinase-like
Other DBs
NCBI-GeneID: 29869
NCBI-ProteinID: NP_038909
MGI: 1352758
Ensembl: ENSMUSG00000004798
Vega: OTTMUSG00000005846
UniProt: Q9QY01 Q3UG39
Position
11; 11 B2
AA seq 1037 aa
MEVVGDFEYCKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSKSQILLGKEIKIL
KELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQIAAAMR
ILHSKGIIHRDLKPQNILLSYANRRKSNVSGIRIKIADFGFARYLHSNTMAATLCGSPMY
MAPEVIMSQHYDAKADLWSIGTVIYQCLVGKPPFQANSPQDLRMFYEKNRSLMPSIPRET
SPYLANLLLGLLQRNQKDRMDFEAFFSHPFLEQVPVKKSCPVPVPVYSGPVPGSSCSSSP
SCRFASPPSLPDMQHIQEENLSSPPLGPPNYLQVSKDSASNSSKNSSCDTDDFVLVPHNI
SSDHSYDMPMGTTARRASNEFFMCGGQCQPTVSPHSETAPIPVPTQVRNYQRIEQNLIST
ASSGTNPHGSPRSAVVRRSNTSPMGFLRVGSCSPVPGDTVQTGGRRLSTGSSRPYSPSPL
VGTIPEQFSQCCCGHPQGHEARSRHSSGSPVPQTQAPQSLLLGARLQSAPTLTDIYQNKQ
KLRKQHSDPVCPSHAGAGYSYSPQPSRPGSLGTSPTKHTGSSPRNSDWFFKTPLPTIIGS
PTKTTAPFKIPKTQASSNLLALVTRHGPAESQSKDGNDPRECSHCLSVQGSERHRSEQQQ
SKAVFGRSVSTGKLSEQQVKAPLGGHQGSTDSLNTERPMDVAPAGACGVMLALPAGTAAS
ARAVLFTVGSPPHSATAPTCTHMVLRTRTTSVGSSSSGGSLCSASGRVCVGSPPGPGLGS
SPPGAEGAPSLRYVPYGASPPSLEGLITFEAPELPEETLMEREHTDTLRHLNMMLMFTEC
VLDLTAVRGGNPELCTSAVSLYQIQESVVVDQISQLSKDWGRVEQLVLYMKAAQLLAASL
HLAKAQVKSGKLSPSMAVKQVVKNLNERYKFCITMCKKLTEKLNRFFSDKQRFIDEINSV
TAEKLIYNCAVEMVQSAALDEMFQQTEDIVYRYHKAALLLEGLSKILQDPTDVENVHKYK
CSIERRLSALCCSTATV
NT seq 3114 nt   +upstreamnt  +downstreamnt
atggaggtggtgggcgacttcgagtactgcaagcgggacctcgtgggacacggggccttc
gctgtggtcttccgggggcggcaccgccagaaaactgattgggaggtggctattaaaagt
attaataaaaagaacttgtcaaaatcacaaattctgcttggaaaggaaataaaaatctta
aaggagcttcagcatgaaaacatcgtagcgctctatgatgttcaggaattgcccaactct
gtctttctggtgatggagtattgcaatggtggagacctggcagattatttgcaagctaaa
ggaactctgagtgaagatactatcagagtgtttctccatcagattgcggcagccatgcga
atcctgcacagcaaagggataatccacagggatctcaaaccacagaatatcctgttgtct
tatgccaatcgaaggaagtcgaatgtcagtggtattcgtattaaaatagctgattttggt
ttcgcacggtacctacatagtaacacaatggcagcgacactgtgtggatccccaatgtac
atggctcccgaggttattatgtctcaacattatgatgctaaggcagatttatggagcata
ggaacagtgatctatcaatgcctagttggaaaaccaccttttcaggctaatagtcctcag
gacctaaggatgttttatgaaaaaaacaggagcttaatgcctagtattcccagagaaaca
tcaccttacttggctaatctccttttgggtttgcttcagagaaatcaaaaggatagaatg
gactttgaagcatttttcagccatcctttccttgagcaagttccagttaaaaaatcttgc
ccagtcccagtgcctgtgtattctggccctgtccctggaagctcctgcagcagctcacca
tcttgtcgctttgcttctccaccatcccttccagatatgcagcatattcaggaagaaaac
ttatcctccccaccgttgggtcctcccaactatctacaggtgtccaaagactctgcgagt
aatagtagcaagaactcttcttgtgacacggatgactttgttttggttccacacaacatc
tcgtcagaccactcatatgacatgccaatggggactacggccagacgtgcttcaaatgaa
ttctttatgtgtggagggcagtgtcaacctactgtgtcacctcacagcgaaacagcccca
attccagttcctactcaagtaaggaattatcagcgcatagaacagaatcttatatccact
gccagctctggcacaaacccacatggttctccaagatctgcagtagtacgaaggtctaat
accagccccatgggcttcctccgggttgggtcctgctcccctgtaccaggagacacagtg
cagacaggaggacgaagactctctactggctcttccaggccttactcaccatcccctttg
gttggtaccattcctgaacagtttagtcagtgctgctgtggacatcctcagggccatgaa
gccaggagtaggcactcctcaggttctccagtgccacagacccaggcaccacagtcactc
ttactgggtgctagactgcagagtgcacccaccctcaccgatatctatcagaacaagcag
aagctcagaaagcagcactctgaccctgtgtgtccgtcccatgctggagctgggtatagt
tactcacctcagcctagtcggcctggcagccttgggacctctcccaccaagcacacgggg
tcctctccacggaattctgactggttctttaaaactcctttaccaacaatcattggctct
cctactaagactacagctcctttcaaaatccctaaaacacaagcatcttctaacctgtta
gccttggttactcgtcatgggcctgctgaaagccagtccaaagatgggaatgaccctcgt
gagtgttcccactgcctctcagtacaaggaagcgagaggcatcgatctgagcagcagcag
agcaaggcagtgtttggcagatctgtcagtactgggaagttatcagaacaacaagtaaag
gcacctttaggtggacaccagggcagcacggatagtttaaacacagaacgaccaatggat
gtagctcctgcaggagcctgtggtgttatgctggcattgccagcaggaacagcagcaagc
gccagagctgtcctcttcaccgtggggtctcctccacacagtgccacagcccccacttgt
actcatatggtccttcgaacaagaaccacctcagtggggtccagcagctcaggaggttcc
ttgtgttctgcaagtggccgagtatgtgtgggctcccctcctggaccagggttgggctct
tccccaccaggagcagagggagctcccagcctaagatacgtgccttatggtgcttcacca
cccagcctagagggtctcatcacctttgaagcccctgaactaccagaggagacactgatg
gagcgagagcacacagacaccttacgccatctgaacatgatgttaatgtttactgagtgt
gtgctggacctgacggcagtgaggggtgggaaccctgagctgtgcacatctgctgtgtcc
ttgtaccagattcaggagagtgtagttgtggaccagatcagccagctaagcaaagattgg
gggcgggtggagcagctggtgttgtacatgaaggcagcacagctgctggcggcttccctg
catctcgccaaagctcaggtcaagtctgggaagctgagcccatccatggctgtgaaacaa
gttgttaaaaatctgaatgaaagatacaaattctgcatcaccatgtgcaagaaacttaca
gaaaagctgaatcgcttcttctccgataaacagagatttattgatgaaatcaacagtgtg
actgcagagaaactcatctataattgtgctgtggaaatggttcaatctgcagccctggat
gagatgtttcagcagactgaagacatcgtttatcgctaccacaaggcagcccttcttttg
gaaggcttaagtaagatcctgcaggaccctacagatgttgaaaatgtgcataagtataaa
tgtagtattgaaagaagattgtcagcactctgctgtagcactgcaactgtgtga

DBGET integrated database retrieval system