KEGG   Mus musculus (house mouse): 22245
Entry
22245             CDS       T01002                                 
Symbol
Uck1, URK1, Umpk
Name
(RefSeq) uridine-cytidine kinase 1
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00240  Pyrimidine metabolism
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    22245 (Uck1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    22245 (Uck1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine/cytidine kinase
     22245 (Uck1)
SSDB
Motif
Pfam: PRK CoaE AAA_18 AAA_17 Zeta_toxin AAA_16 T2SSE AAA_33
Other DBs
NCBI-GeneID: 22245
NCBI-ProteinID: NP_035805
MGI: 98904
Ensembl: ENSMUSG00000002550
UniProt: P52623 A2AN37 Q3V218
Position
2:complement(32145014..32150117)
AA seq 283 aa
MSVAPDMASAGGGGSESAAPEADRPQPRPFLIGVSGGTASGKSTVCEKIMELLGQNEVDR
RQRKLVILSQDCFYKVLTAEQKAKALKGQYNFDHPDAFDNDLMHKTLKNIVEGKTVEVPT
YDFVTHSRLPETTVVYPADVVLFEGILVFYTQEIRDMFHLRLFVDTDSDVRLSRRVLRDV
QRGRDLEQILTQYTAFVKPAFEEFCLPTKKYADVIIPRGVDNMVAINLIVQHIQDILNGD
LCKRHRGGPNGRNHKRTFPEPGDHPGVLATGKRSHLESSSRPH
NT seq 852 nt   +upstreamnt  +downstreamnt
atgtccgtcgctccggatatggcttcggcgggaggcggcggctcggagagcgccgcgccc
gaggccgatcgtccccagccgcggccgttcctcatcggcgtgagcggcggcaccgctagt
ggcaagtcaacagtgtgtgagaagatcatggagctgctgggacagaacgaagtggaccgc
cggcagcgcaagttggtcatcctgagccaggactgcttctacaaggttctgacggccgag
cagaaggccaaggctttgaagggacagtacaattttgaccacccagatgcttttgataat
gatctgatgcacaagaccctgaaaaacattgttgaaggcaaaactgtcgaggtccctacc
tatgattttgtgacccactcaaggttaccagagaccactgtggtctacccagctgatgtg
gttctgttcgagggcatcttggtattctacacccaggagatccgggacatgttccacctg
cgcctctttgtggacacagactctgatgttaggctgtctcgaagagttctccgggatgtg
caacgaggaagggacctggagcagatcctgactcagtacaccgcctttgtgaaaccagcc
tttgaggagttctgcctgccgactaagaagtacgctgacgtgatcatccctcgaggagtt
gataatatggtggccatcaacctgatcgtgcaacacatccaggacatcctcaacggggac
ctgtgcaagcggcaccgaggcgggcccaacgggcgcaaccacaagaggaccttccccgag
ccaggagatcaccctggggtgttggccactggcaagcgctcacacctggagtctagcagc
agaccccattga

DBGET integrated database retrieval system