KEGG   Mus musculus (mouse): 22249
Entry
22249             CDS       T01002                                 

Gene name
Unc13b, Munc13-, Munc13-1, Munc13-2, Unc13a, Unc13h, Unc13h1, Unc13h2
Definition
(RefSeq) unc-13 homolog B
  KO
K15293  protein unc-13 A/B/C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    22249 (Unc13b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    22249 (Unc13b)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    22249 (Unc13b)
SSDB
Motif
Pfam: Membr_traf_MHD C2 DUF1041 C1_1
Other DBs
NCBI-GeneID: 22249
NCBI-ProteinID: NP_067443
MGI: 1342278
Ensembl: ENSMUSG00000028456
Vega: OTTMUSG00000006761
UniProt: Q9Z1N9
Position
4; 4 A5
AA seq 1602 aa
MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETLMKDDEICGTKNPTPHK
ILLDTRFELPFDIPEEEARYWTYKLEQINALADDNEYSSQEESQRKPLPTAAAQCCHWTY
LGWGEHQTFEDPDSAVDDRDSDYRSETSNSAPPPYHTTTQPNASVHQFPVPVRLPQQLFL
QGSSHDSCNDSMQSYDLDYPERRALSPTSSSRYGSSCNVSQGSSLLSELDQYHEQDDDGR
ERDSIHSSHSYGSLSKDGQAGLGEQEKALEVTCESEKEKTGESKEMRDDATIHPPSDLVL
HKDHVLGPQESLPEETASSPFTQARAHWFRAVTKVRLQLQEISDDGDPSLPQWLPEGPAG
GLYGIDSMPDLRRKKPLPLVSDLSLVQSRKAGITSAMATRTSLKDEELKSHVYKKTLQAL
IYPISCTTPHNFEVWSATTPTYCYECEGLLWGLARQGMRCSECGVKCHEKCQDLLNADCL
QRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVSKVAHVQQMKTVK
QSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVWE
EKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYN
LEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGGVWIPEA
RGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANI
NAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQ
DLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSHQYQ
LQEQPLEEPGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLSQFPQELNVGKVSAEVMWH
LFAQDMKYALEEHEKDRLCKSADYMNLHFKVKWLHNEYVRDLPALQGQVPEYPAWFEQFV
LQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECP
DPNILAHYMRRFAKTIGKVLMQYADILSKNFPAYCTKERLPCILMNNMQQLRVQLEKMFE
AMGGKELDSEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADILGQVRGTGN
ASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERVIV
LPPLTDQTGTQLILTAAKELSQLSKLKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAG
GNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTAQGAGVDDPVGEVSIQVDL
FTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWTP
KYNETFHFLLGNEEGPEAYELQICVKDYCFAREDRVIGLAVMPLRDVAAKGSCACWCPLG
RKIHMDETGMTILRILSQRSNDEVAREFVKLKSESRSTEEGS
NT seq 4809 nt   +upstreamnt  +downstreamnt
atgtcgctgctctgtgtgcgtgttaaaagagccaaattccagggttcaccagataaattt
aacacatatgtgaccctgaaagtccagaacgtgaagagcacaactgtagcagttcgtggt
gatcagccttcctgggagcaggatttcatgtttgagatcagtcgtctggacctgggccta
agtgtggaggtgtggaacaagggactgatatgggacacaatggtgggcaccgtgtggatt
gcactgaagacaatccgtcagtcggatgaggaagggcccggggagtggtctacactggag
gcagagacgttaatgaaagatgatgagatctgtggaactaaaaatccaactcctcataaa
atcttgcttgatacaagatttgagctgccttttgacatcccagaggaggaagccagatat
tggacctacaaattggagcaaatcaatgccttggcagatgataatgagtattctagtcaa
gaagaaagccagaggaagccattacccactgctgccgcccagtgttgtcactggacctat
ttgggctggggagagcatcagacctttgaagaccctgatagtgccgttgatgaccgagac
agtgactaccgcagtgagaccagcaatagcgccccacctccttaccacacgactacccag
cccaacgcttctgtacaccagttccctgttcctgtgcggctgccacagcagctctttctt
caaggcagttcccatgactcttgcaatgactctatgcagagttacgaccttgattatcca
gagcgtcgggccctcagccctaccagcagtagtaggtatggctcctcctgtaatgtgagt
caaggaagctctctgctgagtgagctggaccagtatcatgagcaagatgatgatggtcgg
gagagggactccattcattctagtcatagctatggcagcctctccaaagatggccaggct
ggtttgggagaacaagagaaagccttggaagtgacatgtgaatcagaaaaagagaaaaca
ggtgaatccaaggagatgagagatgatgctacaatccaccctccttcagatctggtgctg
cataaggaccatgtcctaggaccccaggagagtcttcctgaggagaccgcatcatcgcca
tttacccaggccagagcacactggttccgagcggttaccaaggtccgactccaactgcag
gagatttcagatgatggtgacccctccttgcctcagtggctcccagaagggccagctgga
gggctctatggcattgacagcatgccagatctacgaaggaagaagccactgccacttgtc
agtgatctgtcactggtccagtcacggaaagctgggattacatctgctatggctacacgt
acctctctcaaggatgaagaactgaaatctcatgtgtataagaaaactctgcaggcctta
atctaccccatctcgtgtaccacgccccacaactttgaggtctggtctgccactacacct
acctattgctatgagtgtgaaggcttgctctggggccttgcccggcaaggcatgcgctgc
agcgagtgtggagtcaagtgccatgagaagtgccaggacctgctcaatgctgactgccta
cagcgggctgctgaaaagagctctaagcatggagctgaggaccgaactcagaacattatc
atggccatgaaggaccgtatgaagatccgagaacggaataaaccagagatctttgaggtt
atccgggatgtgttcacagtgagcaaagttgcgcatgtgcagcagatgaaaacagtaaag
cagagtgtcctggatggcacctccaagtggtcagccaaaattaccatcacggtggtttgt
gcccagggcctacaagccaaagacaagacaggatccagtgacccttatgtgactgtgcaa
gttgggaaaaccaagaagcgcaccaagaccatttttggaaatttgaatcctgtttgggaa
gagaagttccattttgagtgccacaactcttctgatcgaattaaggtacgcgtgtgggat
gaggatgatgacatcaagtccagagtaaagcagcggctaaagcgagagtcagatgatttc
cttggccaaactatcattgaagttcgaacgctgagtggagagatggatgtctggtacaat
ctggagaagagaacagacaagtcagctgtctcaggggctatccgacttcaaatcagtgtg
gagatcaagggggaggagaaggtagccccataccatgtacaatatacatgtctccatgag
aaccttttccattacctcacagacattcagggcagtggaggagtctggatcccagaggct
cggggggacgatgcatggaaggtgtactttgatgagacagcccaagaaattgtggatgaa
ttcgctatgcgctatggcatcgagtccatttatcaggccatgacgcactttgcatgtttg
tcatccaagtacatgtgtcctggtgtaccagccgtgatgagcaccttactggccaacatc
aatgcctattatgctcacacaactgcctccactaacgtctctgcatctgatcgttttgca
gcctccaactttggtaaagaaagatttgtaaaactgctggaccagctacacaactcactg
aggatagacctctctacatacaggaataactttcctgctgggagccctgagcggcttcag
gatttaaagtctacagtggatttgctgaccagcattactttcttcaggatgaaggtgcaa
gaacttcagagccctccaagagccagccaggtggtaaaggactgtgtgaaagcctgcttg
aactctacatatgaatacatcttcaacaactgccatgacctctacagtcaccagtatcag
ctgcaggaacaacctctagaggaaccagggcccagcattcggaacttggatttctggccc
aaacttatcacactcattgtttcgatcatagaggaggataagaattcctacacacctgtt
ctgagccagtttcctcaggagttgaacgtaggaaaagtcagtgcagaagtgatgtggcat
ctgtttgctcaagacatgaaatatgcactggaggaacacgagaaagaccggctgtgtaag
agtgctgactacatgaacctgcacttcaaggtgaagtggctccacaatgaatatgtgcgc
gatctgcctgccctccaggggcaagtgcctgagtacccagcgtggtttgagcagtttgtg
ctacagtggctagatgagaatgaagatgtgtcactggaattccttcgtggggccttggaa
cgagataagaaggatgggttccagcagacatcagagcatgccttgttttcctgttctgtg
gtggatgtctttacacaactcaaccagagctttgagatcatccggaagttggaatgtcca
gaccccaacatccttgcccactacatgagaaggtttgctaagaccattgggaaagtgctg
atgcagtatgcagacatcttatcaaagaacttcccagcttactgcacaaaggagagactg
ccctgtatcctgatgaacaacatgcagcaactgagggtccagctggagaaaatgtttgag
gccatgggaggcaaagagctggactccgaagctgcagacagtctgaaggagctgcaggtg
aaactgaatacagttctggatgagcttagcatggtgtttggaaacagcttccaggtgcgg
attgatgaatgtgttcgacaaatggctgacatcctgggccaagttcggggcacagggaat
gcatcccctaacgccagggcctcggtggctcaggatgcagatagtgtgctgcgacctctc
atggacttcctggatggcaacctcacgctgtttgccactgtgtgtgagaagacagttctg
aagcgggtcctgaaggagctctggcgggtggtgatgaacaccatggagcgggttattgtc
ctgcccccactcactgaccagacgggcacccagctgatcttaactgctgccaaggagctg
agccagctttccaaactcaaggaccacatggtacgggaggaaacacggaatctcactcca
aagcagtgtgctgtcctcgacttggccttggacaccatcaagcaatacttccatgcagga
ggcaatggtctgaagaaaaccttcctggaaaagagcccagacctgcagtctctgcgttat
gccctctctctgtatacacagactacagacactctcatcaagacatttgtgcgctcacag
actgcccagggggctggtgtggatgaccccgtgggagaagtctctattcaggtggactta
tttacacatcctggcactggggagcataaggtcacagtgaaagtggtagcagccaatgac
ctcaagtggcagacagcgggtatgttccggccttttgtggaagtgaccatggttggccca
caccaaagtgataagaagaggaagttcacaaccaagtctaaaagtaacaactggactccc
aagtacaacgagacgtttcacttcctcctgggaaatgaagagggtccagaggcctatgaa
ttgcagatctgtgtgaaggattactgctttgcccgggaggatcgtgtgataggactggca
gtgatgcccctgagggatgtggcagctaagggcagctgtgcctgctggtgcccactgggc
cggaagatccatatggatgagacaggcatgaccattctccggattctgtctcagaggagc
aatgacgaggtagcccgagagttcgtgaagctcaaatcagagtctcgatccacagaggaa
gggagctga

DBGET integrated database retrieval system