KEGG   Mus musculus (house mouse): 22253
Entry
22253             CDS       T01002                                 
Symbol
Unc5c, B130051O18Rik, Unc5h3, rcm
Name
(RefSeq) unc-5 netrin receptor C
  KO
K07521  netrin receptor unc-5
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    22253 (Unc5c)
SSDB
Motif
Pfam: UPA ZU5 Death Ig_3 I-set TSP1_spondin TSP_1 Ig_2 ig TSP1_ADAMTS AtuA Adeno_E3_CR2
Other DBs
NCBI-GeneID: 22253
NCBI-ProteinID: NP_033498
MGI: 1095412
Ensembl: ENSMUSG00000059921
UniProt: O08747
Position
3:141171325..141540685
AA seq 931 aa
MRKGLRATAARCGLGLGYLLQMLVLPALALLSASGTGSAAQDDEFFHELPETFPSDPPEP
LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHVVDERVDETSGLIVR
EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSL
EQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCV
AKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCE
GQSVQKIACTTLCPVDGRWTSWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSK
NCTDGLCMQAAPDSDDVALYVGIVIAVTVCLAITVVVALFVYRKNHRDFESDIIDSSALN
GGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIK
VYNSSGAVTPQDDLAEFSSKLSPQMTQSLLENEALNLKNQSLARQTDPSCTAFGTFNSLG
GHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQTLLTPVVSCGPPGAL
LTRPVILTLHHCADPSTEDWKIQLKNQAVQGQWEDVVVVGEENFTTPCYIQLDAEACHIL
TENLSTYALVGQSTTKAAAKRLKLAIFGPLCCSSLEYSIRVYCLDDTQDALKEVLQLERQ
MGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIWSGSQRNLHCT
FTLERLSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPASTITTVTGPS
AFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQN
FPDGNLSMLAAVLEEMGRHETVVSLAAEGQY
NT seq 2796 nt   +upstreamnt  +downstreamnt
atgaggaaaggtctgagggcgacagcggcccgctgcggactgggactaggatacttgctg
cagatgcttgtgttacctgccctggccctgctaagcgccagtggcaccggctccgccgct
caagatgatgaattttttcacgaactcccagaaacctttccatctgacccacctgagcca
ttgccacacttcctcattgagcccgaggaagcttacattgtgaagaacaagcctgtgaac
ctgtattgtaaagccagccctgccacccagatctacttcaagtgcaacagcgagtgggtt
catcagaaggaccacgtagtagacgagagagtagatgaaacctctggtctaattgtgaga
gaagtgagcattgagatttcacgccagcaggtggaggaactgtttgggcctgaagattac
tggtgccagtgtgtggcctggagctcagcaggcactacgaagagtcggaaggcatacgtg
cgcattgcgtatctgcggaagacattcgagcaggaacccttgggaaaggaagtgtccttg
gagcaggaagtcttactccagtgtcggccacctgaagggatcccagtggctgaggtagaa
tggctaaagaatgaagacataattgatcctgctgaagatcggaacttttatattactatc
gatcacaacctgatcatcaagcaagcccgactctcagatacagcaaattatacctgtgtt
gccaaaaatattgttgccaagagaaaaagcaccacagccactgtcatcgtgtatgttaat
ggtggctggtccacctggacagagtggtctgtgtgtaacagccgctgtgggcgaggatat
cagaaacgcacaagaacctgcaccaacccagccccactcaatggtggggccttctgtgag
gggcagagtgtgcagaaaatagcatgcactacgttatgtccagtggatggtaggtggact
tcatggagcaaatggtcaacctgtgggactgaatgcacccactggcgcaggagggagtgt
acagcaccagcccccaagaacgggggtaaggactgtgatggcctggtcctccaatccaag
aactgcactgatgggctgtgcatgcaggctgctcctgactcagatgatgtggctctctac
gtggggattgtgatcgctgtaacagtctgtctggcgatcactgttgtggtggccctgttt
gtgtatcggaagaaccaccgtgactttgagtctgacatcattgactcctcagcactcaat
ggcggctttcagcctgtgaacatcaaggctgccagacaagatctcctggctgtcccccct
gacctcacctcagctgcagccatgtacaggggacctgtctatgctctgcatgatgtctca
gacaaaatcccaatgaccaactctccaattctggacccactacccaacttgaaaatcaaa
gtgtacaacagctcaggtgctgtcactcctcaggatgaccttgccgagttctcatccaaa
ctgtcaccccagatgacccagtccttgctagagaatgaggcccttaacctgaagaaccag
agcctcgcaagacagactgacccatcctgcacagcatttggtaccttcaactctcttggg
ggtcacctcatcattcctaattcaggagtaagcttgctgattcccgctggggccattcct
caggggagagtctatgaaatgtatgtgactgtacacaggaaagaaaatatgaggcccccc
atggaagactctcagaccctacttacccctgtggtgagctgtgggcctcctggagctctg
ctgacccgccctgtcatcctcactctgcatcactgtgcagaccccagcaccgaggactgg
aagatccagctcaaaaaccaggcagtgcagggacaatgggaggatgttgtggtggttggg
gaggagaacttcacaaccccctgttacattcagctggatgcagaggcttgccatatcctc
acagagaacctcagtacctatgccctggttgggcagtccaccaccaaagcagctgccaag
cgtcttaaactggccatctttgggcccctctgctgctcttccctggagtacagcattaga
gtctactgcctggatgacacacaggatgccctgaaggaagttctacaactggagaggcaa
atgggaggacagctcctagaagaacccaaggctcttcattttaaaggcagcatccacaac
ctgcgcctgtctattcatgacatcgcccattccctctggaagagcaaattgctggctaag
tatcaggaaattccattttaccacatctggagtggctctcaaagaaacctccactgcacc
ttcactctggaaagactcagcctaaacacagtggaactggtttgcaaactctgtgtgcgg
caggttgaaggagaagggcagatcttccagctcaactgtactgtgtcagaggaacctact
ggcatcgacttacctctcctggaccctgctagtaccatcaccactgtcaccggaccaagt
gctttcagcattcctctccctatccggcagaagctatgcagcagcctggatgcccctcaa
acaagaggccatgactggaggatgctggcccataaactcaacctggacaggtacttgaat
tactttgccaccaaatcgagcccaactggcgtaatcctggatctttgggaagcacagaac
ttcccagatggaaacctgagcatgctggcagccgtcctggaagaaatgggaagacatgag
acagtggtgtccttggcagcagaaggacagtattga

DBGET integrated database retrieval system