KEGG   Mus musculus (mouse): 22256
Entry
22256             CDS       T01002                                 

Symbol
Ung, UNG1, UNG2
Name
(RefSeq) uracil DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03410  Base excision repair
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    22256 (Ung)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    22256 (Ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    22256 (Ung)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     22256 (Ung)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     22256 (Ung)
 Prokaryotic type
     22256 (Ung)
SSDB
Motif
Pfam: UDG Toxin_ToxA
Other DBs
NCBI-GeneID: 22256
NCBI-ProteinID: NP_001035781
MGI: 109352
Ensembl: ENSMUSG00000029591
Vega: OTTMUSG00000013709
UniProt: P97931
Position
5; 5 F
AA seq 306 aa
MIGQKTLYSFFSPTPTGKRTTRSPEPVPGSGVAAEIGGDAVASPAKKARVEQNEQGSPLS
AEQLVRIQRNKAAALLRLAARNVPAGFGESWKQQLCGEFGKPYFVKLMGFVAEERNHHKV
YPPPEQVFTWTQMCDIRDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIFKELS
TDIDGFVHPGHGDLSGWARQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNLS
GLVFLLWGSYAQKKGSVIDRKRHHVLQTAHPSPLSVHRGFLGCRHFSKANELLQKSGKKP
INWKEL
NT seq 921 nt   +upstreamnt  +downstreamnt
atgatcggccagaagaccctatactctttcttctctccgacccccacagggaagcggacc
acgcgcagcccggagccggtcccagggagcggagtggcggccgagatcggcggcgatgcc
gtggccagccccgccaagaaggcccgggtggagcagaacgagcaaggctcgccgctcagc
gccgagcagctcgtccgcatccagaggaacaaggccgcggcgctgctcaggctcgccgcc
cgcaacgtgcctgccggcttcggcgagagctggaagcagcagctgtgcggggagttcggg
aagccgtacttcgtcaagctaatgggatttgttgctgaagaaaggaaccaccacaaggtc
tatccgcccccggagcaggtgttcacatggacccagatgtgcgacatccgagatgtgaag
gttgtcattctgggacaggatccctatcacggacctaatcaagctcacgggctctgcttc
agtgtccaaagaccagttccacccccgcccagtttggaaaacatttttaaagagctgtct
acagacatcgatggttttgttcatcctggccatggggatttgtcagggtgggcccgacaa
ggtgtcctcctcctcaacgccgtcctcactgtccgcgcccaccaagccaattcccataag
gagaggggctgggagcagttcacggacgcggtcgtgtcctggctgaatcagaacctgagt
ggcctcgtcttcctcctctggggctcttatgctcagaagaagggcagtgtcattgacagg
aagcgtcaccatgtcctgcagacagctcacccctccccgctgtcggtgcacagagggttc
ctgggatgcagacatttttctaaagccaatgaactgctccagaagtctggcaagaagccc
atcaactggaaggagctgtga

DBGET integrated database retrieval system