KEGG   Mus musculus (mouse): 22260Help
Entry
22260             CDS       T01002                                 

Gene name
Nr1h2, AI194859, LXR, LXRB, LXRBSV, LXRbeta, NER1, OR-1, RIP15, UR, Unr, Unr2
Definition
(RefSeq) nuclear receptor subfamily 1, group H, member 2
  KO
K08535  liver X receptor beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    22260 (Nr1h2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22260 (Nr1h2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    22260 (Nr1h2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone-like
    22260 (Nr1h2)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1H. Liver X receptor like receptor
   22260 (Nr1h2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 22260
NCBI-ProteinID: NP_001272446
MGI: 1352463
Ensembl: ENSMUSG00000060601
Vega: OTTMUSG00000023074
UniProt: Q60644
Position
7; 7 B3
AA seq 446 aa AA seqDB search
MSSPTSSLDTPVPGNGSPQPSTSATSPTIKEEGQETDPPPGSEGSSSAYIVVILEPEDEP
ERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVHGGAGRYACRGSG
TCQMDAFMRRKCQLCRLRKCKEAGMREQCVLSEEQIRKKRIQKQQQQQPPPPSEPAASSS
GRPAASPGTSEASSQGSGEGEGIQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLG
ADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLE
TARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIA
INIFSADRPNVQEPSRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVH
SEQVFALRLQDKKLPPLLSEIWDVHE
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcccccacaagttctctggacactcccgtgcctgggaatggttctcctcagccc
agtacctccgccacgtcacccactattaaggaagaggggcaggagactgatcctcctcca
ggctctgaagggtccagctctgcctacatcgtggtcatcttagagccagaggatgagcct
gagcgcaagcggaagaaggggccggccccgaagatgctgggccatgagctgtgccgcgtg
tgcggagacaaggcttcgggcttccactacaacgtgctcagctgtgaaggctgcaaaggc
ttcttccggcgcagtgtggtccacggtggggccgggcgctatgcctgtcggggcagcgga
acctgccagatggatgccttcatgcggcgcaagtgccagctctgccggctgcgcaagtgc
aaggaggctggcatgcgggagcagtgcgtgctctctgaggagcagattcggaagaaaagg
attcagaagcagcaacagcagcagccaccacccccatctgagccagcagccagcagctca
ggccggccagcggcctcccctggcacttcggaagcaagcagccagggctccggggaagga
gagggcatccagctgaccgcggctcaggagctgatgatccagcagttagttgccgcgcag
ctgcagtgcaacaaacgatctttctccgaccagcccaaagtcacgccctggcccctgggt
gcagaccctcagtcccgagatgcccgtcagcaacgctttgcccacttcaccgagctagcc
atcatctcggtccaggagattgtggactttgccaagcaggtgccagggttcttgcagttg
ggccgggaggaccagatcgccctcctgaaggcgtccaccattgagatcatgttgctagaa
acagccagacgctacaaccacgagacagaatgcatcacgttcctgaaggacttcacctac
agcaaggacgacttccaccgtgcaggcttgcaggtggaattcatcaatcccatcttcgag
ttctcgcgggccatgcggcggctgggcctggacgatgcagagtatgccttgcttatcgcc
atcaacatcttctcagccgatcggcctaatgtgcaggagcccagccgtgtggaggccctg
cagcagccctacgtggaggcgctcctctcctacacgaggatcaagcgcccacaggaccag
ctccgcttcccacgcatgctcatgaagctggtgagcctgcgcaccctcagctccgtgcac
tcggagcaggtctttgcattgcgactccaggacaagaagctgccgcccttgctgtccgag
atctgggatgtgcacgagtag

DBGET integrated database retrieval system