KEGG   Mus musculus (mouse): 22264
Entry
22264             CDS       T01002                                 

Symbol
Prap1, Upa
Name
(RefSeq) proline-rich acidic protein 1
  KO
K21250  proline-rich acidic protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    22264 (Prap1)
SSDB
Motif
Pfam: PRAP LPAM_1
Other DBs
NCBI-GeneID: 22264
NCBI-ProteinID: NP_033501
MGI: 893573
Ensembl: ENSMUSG00000025467
Vega: OTTMUSG00000027344
UniProt: Q80XD8
Position
7; 7 F4
AA seq 149 aa
MKRFLLATCLVAALLWEAGAAPAHQVPVKTKGKHVFPEQETEKVWDTRALEPLEKDNQLG
PLLPEPKQKPAAAEEKRPDAMTWVETEDILSHLRSPLQGPELDLDSIDHPMSDDVQDEEV
PQSRPILYRQVLQGPEEDLDHLAHSMEDS
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaagaggtttctcctggccacctgtttggtggctgcactgctgtgggaggcaggcgca
gctccagcacaccaggtccctgtcaagaccaaaggcaaacatgtgttccctgaacaggaa
acagagaaggtctgggatactagagccctggagcctcttgaaaaggacaaccagctgggg
ccactgcttcctgaacccaaacagaagcctgcagctgccgaggaaaagcgtccagatgcc
atgacctgggtggagactgaggatatcctgagccatcttcgcagtcctcttcagggtcca
gaactggatcttgacagcatagaccatcccatgtctgacgatgtccaggatgaagaagtg
ccccagtcacggcccatcctgtatcgtcaggtgctgcagggaccagaggaggaccttgac
cacctcgcccactctatggaggattcttga

DBGET integrated database retrieval system