KEGG   Mus musculus (mouse): 22275Help
Entry
22275             CDS       T01002                                 

Gene name
Urod, AI323803, UPD, Uro-d
Definition
(RefSeq) uroporphyrinogen decarboxylase
  KO
K01599  uroporphyrinogen decarboxylase [EC:4.1.1.37]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00860  Porphyrin and chlorophyll metabolism
mmu01100  Metabolic pathways
Module
mmu_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    22275 (Urod)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.37  uroporphyrinogen decarboxylase
     22275 (Urod)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: URO-D
Motif
Other DBs
NCBI-GeneID: 22275
NCBI-ProteinID: NP_033504
MGI: 98916
Ensembl: ENSMUSG00000028684
Vega: OTTMUSG00000009782
UniProt: P70697
Position
4 D1; 4 53.41 cM
AA seq 367 aa AA seqDB search
MEANGFGLQNFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCR
SPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREERDLER
LRDPAAAASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGSSSTMAQAKRW
LYQRPQASHKLLGILTDVLVPYLIGQVAAGAQALQLFESHAGHLGTELFSKFALPYIRDV
AKRVKAGLQKAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARERVGKAVT
LQGNLDPCALYASEEEIGRLVQQMLDDFGPQRYIANLGHGLYPDMDPERVGAFVDAVHKH
SRLLRQN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgaacgggttcggactccagaatttcccggagctgaagaatgacacgttcctg
agagcagcctggggagaggaaacagactatactcccgtttggtgcatgagacaggcaggc
cgctacttaccagagtttagggaaaccagggctgcccaggacttcttcagcacctgccga
tctcccgaggcttgctgtgaactgactctacagccactacgaaggtttcctctggatgct
gccataattttctctgacatccttgttgtaccccaggcattgggcatggaggtgaccatg
gtacctggcaaaggacccagctttccagagccattaagagaagagcgggacttagagcgt
ctacgggatccagcagcagcggcttcagagttaggctatgtgttccaagccatcaccctt
actcgacaacggctggccggacgtgtgccactaattggctttgctggtgctccgtggacc
ctaatgacatacatggttgaaggcggcagttcaagcaccatggctcaggccaaacgatgg
ctctaccaaaggccacaggccagtcacaagctgcttggcatactcactgatgttctggtc
ccatacctaataggacaagtggctgctggtgctcaggcattgcagctctttgagtcccac
gcaggacatcttggcaccgagctcttcagcaagtttgcactgccctacattcgtgatgtg
gccaagcgagtgaaggctgggttgcagaaggcaggcctggcaccagtgcccatgatcatc
tttgctaaggatggacattttgccctggaagagctggcccaggctggctatgaggtagtt
ggacttgactggacagtggctccaaagaaagcccgggaacgtgtcgggaaggcagtgacc
ctgcaggggaacctggatccctgtgccttgtatgcatctgaggaagagatcggtcggctg
gtgcagcaaatgctggatgactttgggcctcaacgctacattgccaacctagggcatggg
ctttaccctgacatggacccagaacgtgtaggagcctttgtggatgctgtacacaaacat
tcacgcctgcttcgacagaattga

DBGET integrated database retrieval system