KEGG   Mus musculus (mouse): 22283
Entry
22283             CDS       T01002                                 

Symbol
Ush2a, A930011D15Rik, A930037M10Rik, Gm676, Gm983, MUSH, Mush2a, Us, Ush, Ushrn
Name
(RefSeq) usherin
  KO
K19636  usherin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    22283 (Ush2a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   USH complex and associated proteins
    22283 (Ush2a)
SSDB
Motif
Pfam: fn3 Laminin_EGF Pur_ac_phosph_N Laminin_G_2 Laminin_G_1 Laminin_N ChitinaseA_N Laminin_G_3
Other DBs
NCBI-GeneID: 22283
NCBI-ProteinID: NP_067383
MGI: 1341292
Ensembl: ENSMUSG00000026609
Vega: OTTMUSG00000018252
UniProt: Q2QI47 Q9D1Z8
Position
1 H6; 1 92.29 cM
AA seq 5193 aa
MHYLALSPGFLCYTIKTLILAYLASVLVLAASQGVFPRLENVGAFRKVSTVPTHATCGFP
GPSTFCRSPVAAEHVQLCTERLCIQDCPYRSASPLYTALLEGLRSCIPADDGDLHPYSRS
SSVSFMFGSHQNCPSLRAPRLAAELTLAVWLKLEQGGTMCVIEKTVDGQIVFKVTISEKE
TMFYYRTVNGLQPPIKVMTPGRILMKKWIHLTVQVHQTAISFFVDGLEENSTAFDTRTLH
DSVTDSVSSVIQVGQSLNGSEQFVGRMQDFRLYNVSLTNREILEVFSGDFPHLHIQPHCR
CPGSHPRVHPSVQQYCIPNGAGDTPEHRMSRLNPEAHPLSFINDDDVATSWISHVFTNIT
QLYEGVAISIDLENGQYQVLKVITQFSSLQPVAIRIQRKKADSSPWEDWQYFARNCSVWG
MKDNEDLENPNSVNCLQLPDFIPFSHGNVTFDLLTSGQKHRPGYNDFYNSSVLQEFMRAT
QIRLHFHGQYYPAGHTVDWRHQYYAVDEIIVSGRCQCHGHAETCDRTRRPYRCLCSPHSF
TEGPQCDRCSPLYNDKPFRSGDNVNAFNCKPCQCHGHASSCHYDASVDPFPLEHNRGGGG
VCDDCQHHTTGRHCESCQDYFYRPVGADPAAPDACKLCDCNRAGTRNGSLHCDPIGGQCD
CKRRVSGRQCLQCQDGFYDLQALDPDGCRPCNCNPSGTVDGDITCHQNSGQCSCKANVIG
LRCNRCNFGFKFLQSFNGDGCEPCQCNLHGSVNQLCDPLSGQCACKKEAKGLKCDSCREN
FYGLPWSACEVCDCSKAGSQPGTVCDTETGQCVCKPNVGGRQCSQCKAGYFNLYQNDSHL
CLTCNCEKMGTVNGSLRCDKSTGQCPCKLGVTGLRCHQCKPHRFNLTMDNPQGCQACDCD
SLGTLPGSMCDPISGQCLCLPHRQGRRCEQCQPGFYSSPSNATGCLPCLCHTAGAVSHIC
NSVTGQCSCHDPSTTGRSCHQCQESYFRFDPLTGRCRPCHCHVAGASNGTCDAVTGQCFC
KEFVTGSKCDTCVPGASHLDVNNLLGCSKTPSQQPPPRGWVQSSSTINVSWSPPECPNAH
WLTYTLFRNGSEIYTTEDEHPYYTQYFLDTSLSPHTAYSYYIETSNVHSSTRSIPVIYET
KPEVSEGHLNLTHIIPVGSDSITLTWTGLSNSSDPVAKYVLSCTPVDSTEPCVSYEGPET
SATIWNLVPFTQYCFSVQGCTNESCFYSLPIIVTTAQAPPQTQGPPTVWKISPTELRIEW
SPPVDSNGIIISYELYMRRWLSTEESLVFESHGLVSSHSALQSVNPSKNLLQQPQASTFI
SGLEPHTEYAFRVLAVNMAGRVSSAWASERTGESVPVFMAPPSVSPLSPHSLSVSWEKPA
ENFTRGEIIGYKISMVSEHFPLHDVPVMCSKMVHFAKSQDQSYIVRGLEPYRTYSFTVSL
CDSVGCVTSALGSGQTLAAAPAQLRPPMVTGVNSTTVHIRWLPPAGVNGPPPLYHLERKK
SSLPAATAAVTKGTRFVGHGYCRFPRTAHADFIGIKASFRTRVPEGLILLALSPGDQEEY
FTLQLKNGRPYFLYNSQGTLVEVTPTDDPSQGYRDGEWHEIIAVRHQAFGQITLDGQYTG
SSSSLNGSSVTGGYTGLFVGGVPQGHSVLQKRLEIIQRGFVGCLKDVFIMKGYSPSGTWL
PLDWQSSEEQVNVHPSWEGCPTNLEEGVQFLGAGFLELPSDTFHAAKDFEISLKFQTDQL
NGLLLFIHNTEGPDFLAVELKRGLLSFKFNSSLVFTRVDLRLGLADCDGKWNTVSIKKEG
SVVSVRVNALKKSTSQAGGQPLLVNSPVYLGGIPRELQDAYRHLTLEPGFRGCVKEVAFA
RGVVVNLASVSSRAVRVNQDGCLSSDSTVNCGGNDSILVYRGSQQSVYESGLQPFTEYLY
RVTASHEGGAVSSDWSRGRTLGTAPQSVPTPSRAQSINGSSVEVAWNEPAVVKGVLEKYV
LKAYSEDSSQPRVPSASTELHDTSTHSGVLIGLHPFHSYTVTLTACSRAGCTESSQALSI
STPQEAPQEVQAPVAVALPNSLSFFWSLPRQANGIITQYSLYVDGRLVYTGKGQNYTVTD
LRVFAAYEIIVGACTQAGCTNSSQVILHTAQLPPEQVDPPGLTVLDSRTIHVRWKQPRQL
NGILERYILYILNPIHNSTMWSVVYNSTEKLQAHVLHHLSPGGLYLIRLRVCTGGGCTTS
EPSQALMEETIPEGVPAPRAHSYSPDSFNISWTEPEYPNGVITTYELYLDDTLIHNSSGL
SCHAYGFDPGSLHTFQVQACTAKGCALGPLVGNRTLEAPPEGVVNVLVKPEGSREAHVRW
DAPAHPNGRLTYSVHFTGSFYADQAGDNYTLLSGTKTIRGIEGSRLWVLVDGLVPCSHYM
VQVNASNSRGSVLSDPVSVEMPPGAPDGLLSPRLAAAAPTSLQVVWSTPARNNAPGSPRY
QLQMRPGPSTHGRLELFPIPSASLSYEVTGLQPFTVYEFRLVATNGFGTAYSAWTPLMTT
EDKPGPIDAPILINVKARMLSVIWRQPAKCNGAITHYNIYLHGRLYLTVSGRVTNYTVVP
LHPYKAYHFQVEACTSQGCSKSPSSETVWTLPGNPEGIPSPQLFPYTPTSIIVTWQPSAH
LDLLVENVTIERRVKGKKEVRNLVTLARSQAMKFIDNDPALRPWTRYEYRVLGSTLDGGT
NSSAWVEVTTRPCRPSGVQPPTVRVLAPDTVEVSWKAPLMQNGDILSYEIRMPEPLIKMT
NMSSIMLSHLVKHLIPFTNYSVTIVACSGGNGYLAGCTESPPTLATTHPAPPQELAPLSV
ILLSESDVGISWQPPSKPNGPNLRYELLRCKIQQPLASNPPEDLNLWHNIYSGTRWFYKD
KGLSRFTTYEYKLFVHNSVGFTPSREVTVTTLAGSPERGATVTASILNHTAIDVRWKKPT
FQDLQGDVEYYTLFWSSGTSEESLKIFPDVDFHVIGQLSPNVEYQVFLLVFNGVHAINST
VVHVTMWEEEPQGMLPPEVVIINSTAVRVIWTSPSNPNAVVTESSVYVNNKLYKTGTDAP
GSFVLEDLSPFTIYDIQVEVCTKDACVKSNGTQVSTAEDTPSDISIPVIRGITSRSLQID
WTTPANPNGIILGYDVLRKTWRPCSETQKLTDKPRDELCKAVKCQYPGKVCGHTCYSPGT
KVCCDGLLYDPQPGYSCCEDKYIALSPNATGVCCGGRMWEAQPDHQCCSGHYARILPGEI
CCPDERHNRVSVGFGDACCGTMPYATSGSQVCCAGRLQDGYRQQCCGGEMVSQDFQCCGG
GEEGMVYSYLPGMLCCGQDYVNMSETICCSASSGESKAHVRKDDPTPVKCCGTELSPESQ
RCCDGVGYNPLKYVCSDEISAGMAMKETRVCATICPATMKATAHCGRCDFNATTHICTVM
RGPLNPTGKKAVEGLCSAAEEIVHSGDVNTHSFIDRDLKPSTVYEYRISAWNSYGRGFSQ
SVRASTREDVPEGVKAPRWARTGKHEDVIFLQWEEPMQSNGPIIHYILFRDGRERFQGTA
LSFTDTQGIQPLQEYSYQLKACTAAGCAVSCKVVAATTQRSPENVPPPNITAQSSETLHL
SWSVPEKMKDAIKAYQLWLDGKGLIYTDTSDRRQHTVTGLQPYTNYSFTLAVCTSVGCTS
SEPCVGQTLQAAPQGVWVTPRHIIINSTTVELYWNPPERPNGLISQYQLRRNGSLLLVGG
RDNQSFTDSNLEPGSRYIYKLEARTGGGSSWSEDYLVQMPLWTPEDIHPPCNVTVLGSDS
IFVAWPTPGNLLPKIPVEYSILLSGGSVTLLVFSVRHRQSAHLKNLSPFTQYEIRIQACQ
NGGCGVSPGTYVRTLEAAPVGLMPPLLKALGSSCIEVKWMPPTRPNGIITSYVVHRRPAD
TEEESLLFVWSEGALEFTDDTGTLRPFTLYEYRVRAWNSQGAVDSPWSTIQTLEAPPRGL
PAPRVQATSAHSAMLNWTEPEAPNGLISQYHVIYQERPDAAAPGSSTVHAFTVTGTSRQA
HLFGLEPFTTYHIGVVAVNSAGKVSSPWTLIKTLESAPSGLMNFTVEQREKGRALLLQWS
EPVKTNGVIKAYNIFNDGVLEYSGLGRQFLFRRLAPFTLYTLILEACTTAGCAHSVPQPL
WTEEAPPDTQMAPTIQSVGPTNVRLHWSQPASPNGKIIHYEVIRRRSEEEDWGNTTWQAD
GNTVFTEYNTQGNAWVYNDTGLQPWRQYAYRICAWNSAGHTCSSWNVVRTLQAPPDGLSP
PEISYVSMSPLQLLISWLPPRHSNGVIQGYRLQRDGVLPALNFNASTFSYMDSQLLPFST
YSYAILACTGGGCCTSEPTNITTPEVPPSEVSPPVLWDISAHQMNVSWSPPSIPNGKIVK
YLLQCDGEEHLAGQGLSFLLSNLQPSTQYNISLVACTSGGCTASRTTSAWTKEAPPENMD
PPTLHITGPESIEITWTPPRNPHGLIRSYELRRDGAIVYVGLETRYHDFTLAPGVEYSYS
VTATNSRGSVLSPLVKGQTSPSAPSGLQPPKLHSGDALELLADWDPPVRTNGKIINYTLF
VREMFEGKTRAMSINTTHSSFGTRSLTVKHLKPFHRYEVRVQACTALGCTSSEWTSTQTS
EVPPLRQPAPHLEVQTATGGFQPIVAVWWAGPLQPNGKIICFELYRRQVAAWPGTSSSLL
IYNGSFRSFMDSELLPFTEYEYQVWAVNSAGKAASNWTRCRTGPAPPEGLQAPTFHTVSS
TRAVVNISVPSRPNGNISLFRVFSNSSGTHVTLSEGTATQQTLHDLSPFTTYTIGVEACT
CFNCCSRGPTAELRTHPAPPSGLSPPQVQTLGSRMASVHWTPPLLPNGVIHSYELQLQRA
CPPDSAPRCPPSHTERKYWGPGHRASLAGLQPNTAYGVQVVAYNEAGSTASGWTNFSTKK
EMPQYQALFSVDSNASMVWVDWSGTFLLNGHLKEYVVTDGGRRVYSGLDTTLYIPRMVDK
IFFFQVTCTTDIGSVKTPLVQYDAATGSGLVLTTPGEKKGAGTKSTEFYSELWFIMVMAV
VGLILLAIFLSLILQRKIHKEPCIRERPPLVPLQKRMTPLSVYPPGETHVGLADTRLPRS
GTPMSIRSSQSVSVLRIPSQSQLSHAYSQSSLHRSVSQLMDMADKKVVTEDSLWETIMGH
SSGLYVDEEELMNAIKGFSSVTKEHTAFTDTHL
NT seq 15582 nt   +upstreamnt  +downstreamnt
atgcattacctggctctctcaccgggcttcctgtgttacaccattaaaacattgatcctt
gcctatttggcttcggtattggtgttggctgcctcacagggcgttttcccaaggctggag
aatgtgggtgctttcaggaaggtatccactgtgccaacccacgccacgtgtggattccca
ggccctagcactttttgtcgtagcccggtggcggctgagcatgtgcaactgtgtacggag
aggctgtgtatccaggattgcccctaccgctctgcctctcctctctatactgccctccta
gaaggcctccggagctgcatccctgcagacgacggtgatctccacccttactccaggagc
agctccgtgagcttcatgttcggaagtcaccagaactgcccgtctctacgggctccgagg
ctggcagccgaattgaccttagctgtgtggttgaagcttgagcaaggaggcactatgtgt
gtgatagaaaagacagtggacgggcagattgtgttcaaagttacaatatctgagaaagag
accatgttttattatcgcacagtaaatggtttgcagcctccaataaaagtaatgacacca
gggagaattcttatgaagaaatggattcatctcactgtgcaggtgcatcagacggcaatc
agcttctttgtggacggtctggaggagaacagtactgcatttgatacaagaactctccat
gattcagtcacagactcagtctccagcgtgatacaagtaggacagagtttaaatggttca
gagcagtttgttggaagaatgcaagattttcgattgtacaatgtgtcacttacaaacagg
gagattctagaggtcttttctggagattttcctcacttgcacatccagccacattgccga
tgtccaggtagccacccccgtgtccacccctccgttcagcagtactgcattcccaatggt
gcaggagacacgcccgagcatcgaatgtcacggctgaatcccgaagcccaccctctctcc
ttcatcaatgatgacgacgttgctacttcatggatctctcatgtgtttacaaacattacg
cagctctatgaaggagtggctatttctatagacttagaaaatggacagtaccaggtgctt
aaagtcatcacccagttctccagcctacagcctgtggcaattcggatccagaggaagaag
gcagacagctctccctgggaggactggcagtattttgccagaaattgcagtgtttgggga
atgaaggacaatgaagatttggaaaatcccaattctgtcaactgtctccagcttcctgat
tttatcccgttttcccatggtaatgtcacctttgacctcctgacatctggacagaagcat
cgtcctgggtacaacgacttttacaacagctcagtgcttcaagaattcatgagagccact
caaataaggctgcacttccatgggcagtactatccggctggacacactgttgactggaga
caccaatactatgcagtggatgagatcattgtcagtggaagatgccaatgccacggccat
gctgagacctgtgacaggaccagacggccttacagatgtctctgctctccacacagcttc
actgaagggcctcagtgtgatcgatgctcccctctttataatgacaagcctttccgcagt
ggtgacaatgttaatgcattcaactgtaagccttgccagtgccatggccatgccagcagc
tgccactacgatgcttctgtggacccatttcccctggaacacaacagaggcggtggagga
gtctgtgatgactgtcagcatcatacaacagggagacactgtgagtcgtgccaggattac
ttttaccgacctgttggtgctgatcctgctgccccggatgcttgcaagctctgtgactgt
aacagggccgggactagaaatggcagcctccactgtgacccgattggaggccaatgtgat
tgtaagagacgtgtgtctggcagacagtgccttcagtgccaggatggattctatgacctg
caggcgctagatcctgacggctgccgtccctgtaactgtaatccctctgggaccgtggat
ggagacattacctgtcaccaaaattcaggccagtgctcgtgcaaagcgaatgttattggg
cttagatgcaatcgctgcaatttcggatttaaattcctccagagttttaatggtgatgga
tgtgagccttgccaatgtaacctccacggctcagtgaaccaactctgtgatccgctttct
gggcagtgtgcatgcaagaaggaagccaaaggacttaagtgtgactcttgcagagaaaac
ttttatgggttgccctggagtgcttgtgaggtctgtgactgcagcaaggctgggtcccag
cctgggactgtctgtgacactgagacagggcagtgcgtttgtaagcccaatgttggaggg
agacaatgtagtcagtgtaaggcaggctacttcaacctatatcagaatgattcccacctc
tgtttgacttgtaactgcgagaagatgggaacggtaaatggctctctaaggtgtgacaag
tcaaccgggcagtgtccttgcaaactaggggtaactggtctgcgttgccaccagtgcaag
cctcacaggttcaatttgacgatggacaatcctcaaggttgtcaggcgtgcgactgtgac
tcgttggggacattacctggaagcatgtgtgaccccatcagtggccagtgtctatgtcta
cctcatcgacaaggaagaaggtgtgagcagtgtcagccaggcttttacagttctcccagc
aatgccactggctgcctgccatgcttatgccacacagctggtgctgtgagccacatctgt
aatagtgtcacgggacagtgctcttgccatgacccctcaaccactgggcgtagctgtcac
cagtgtcaagaaagttactttagatttgatcccctgactggaagatgcaggccttgtcac
tgtcatgtagcaggagcctcgaatggaacttgtgatgcagtcacaggccagtgtttctgc
aaagagtttgtcactggctcaaaatgtgacacttgtgttcctggtgcaagccacttggac
gtcaacaatctattaggctgcagcaaaactccatctcagcaacctccacccagaggatgg
gttcagagttcttctaccatcaatgtgtcctggagtccacccgagtgcccaaatgctcac
tggcttacatacactctgttcaggaatggctctgagatctacacaactgaagatgaacac
ccgtactatactcagtacttcttagacactagtctgtcaccacacacagcatattcatat
tatatagagacctccaatgtgcacagttcgacaaggagcatacctgtcatttatgagaca
aagccagaggtctcagaaggacacttgaacttgactcacatcattcctgtgggctcggac
tccattacacttacctggactggactctccaacagctctgatcctgtggcaaaatatgtt
ttatcatgcacacctgtggacagcactgagccctgtgtctcctatgaaggtccagaaacc
tcagctaccatctggaatctggttccattcacccagtactgtttttctgtccagggctgt
actaatgagagctgtttctacagcttgcctattatagtaaccacagcccaagcacctcct
caaacgcaggggccacctacagtatggaaaatcagtcccacagaactcagaatagaatgg
tctcctccagtggactcaaatggtataattataagctatgagttatacatgaggagatgg
ctgtccaccgaagaaagcctagtgtttgagagccacggtttggtcagttctcactcagct
ttacagtcggtcaatccgagtaagaacctgctccagcagccccaagccagcacgttcatc
tctggcttggagccacacacagagtatgcatttagggtcttggctgtgaatatggctggc
agggtgtcgtctgcctgggcctcagaaagaacgggggaatcagtacccgtattcatggcc
cctccttcagtctctccactctcaccacactccctcagtgtctcctgggagaagccagca
gaaaactttacaagaggagaaattatagggtacaagatcagcatggtttctgaacatttc
cctctacacgatgttccagtcatgtgctcaaagatggtgcattttgctaagtcccaagac
cagtcttacatcgtaaggggactcgagccttataggacctacagcttcacagtgtccctc
tgcgattccgtgggctgtgtaaccagtgctttgggatcaggacaaaccttagcagcagct
cctgctcagctccggcctcccatggtgacaggagtcaacagtactacagtccatatcagg
tggcttcctcctgcaggagtcaatggaccacctcctttgtaccatctagaaaggaagaag
tcttccctcccagctgccacagctgctgtgacaaagggaacccgcttcgtgggacacggt
tactgcaggtttcccagaacagctcacgcagattttataggaatcaaggccagcttccgg
acaagggtgcctgaagggctgatcctcctggcactgtcccctggcgaccaggaagagtat
ttcaccctgcagttgaagaatggccgtccttactttctttacaattcccagggaacacta
gtggaagttaccccaactgatgatcctagtcaaggatacagggatggagagtggcatgaa
atcatagcagtcagacatcaggcttttggccagattactcttgatggacagtacacaggc
tcctcttcttctctgaatggaagctccgtgacaggaggctacactggactgtttgtgggt
ggagtgccacaaggtcatagcgtcctccagaagaggcttgagataatccaaagaggtttt
gtgggctgcctcaaggatgtgttcatcatgaagggttacagcccctctgggacgtggcta
cctttggattggcagagctctgaggagcaggtgaatgttcatcccagctgggaaggttgt
cccaccaacctagaagaaggagttcagttcctaggagcaggatttctggagcttccttca
gatacgtttcatgctgcaaaggactttgagatctccctgaagtttcaaacagaccaacta
aatggattgcttcttttcattcacaatacagagggaccggattttcttgcggtggagctg
aagagagggctgctgagcttcaagttcaattccagtctcgtctttacacgcgtggatctc
aggctggggctggccgattgtgatggaaagtggaatacagtcagtatcaaaaaggaaggc
tctgtggtatctgtccgtgtgaatgcacttaagaagagcacctcccaggctggaggccag
cctctgctggtgaattctcctgtctatctgggcgggatcccacgggagctgcaggacgcc
tacagacatttgactctggagccagggttccgtggttgcgtgaaggaagttgcatttgca
cggggtgttgtcgttaacttggcatctgtgtccagccgtgctgtcagagtcaatcaggat
ggatgcctatcaagtgacagtactgttaactgtgggggaaatgactccatcctggtttat
cggggaagccagcagagtgtttatgagagcggtctccagccctttacagaatacctgtat
cgggtcacagcctcacacgaaggaggagcggtgtccagtgattggagtcggggacgcaca
ttgggcacagctccgcagagtgtgccaactccctcaagagcccagagcataaacggatcc
agcgttgaggtggcctggaatgagcctgctgtggttaaaggtgtcctggagaagtacgtt
ctgaaagcctacagtgaggacagctcccagccccgcgtgccctctgccagcactgagctt
catgacaccagcacccactcaggcgtgttgataggacttcatcccttccacagctacacg
gtaaccctgactgcttgttctcgggcaggctgcaccgagagctcacaggcattgagcatc
tccactccacaagaagcgccccaggaggtgcaggcaccagtcgccgtggcccttcccaac
tccttgtcattcttttggagtctacccagacaagcaaatgggattattacgcagtactcc
ttatacgtggatgggaggctggtctacacaggcaagggacagaactacacagtcacagat
ttaagagtattcgcagcctacgagattatagttggtgcatgcacacaagcagggtgcaca
aacagctcccaagtcatcttgcacacagcacagctgccgccagagcaagtggatcccccg
ggtttgactgtcctggattctaggactatccatgtacggtggaaacaaccaaggcaacta
aatggaattctggagcgctacatattatatattttgaatcctatacataactccacaatg
tggagtgttgtctataacagcacagaaaaactccaggctcacgtgctccaccacctttcc
cctgggggtctatacctcatcaggctgagagtgtgtaccggtgggggctgcacaacaagt
gagcccagccaggccctaatggaggagacgattccagaaggtgtgccagcccccagagct
cactcctactcaccagactcctttaacatctcctggacagagcctgagtatccgaatgga
gtgatcaccacatatgagttatatctagatgacactctgattcacaattcatcaggactc
agctgccatgcctatggatttgatcctgggagcttacacaccttccaagttcaagcatgc
acggcaaagggttgtgctctgggcccactggtaggaaaccggactctagaagctcctccg
gaaggcgtggtcaacgtgcttgtcaaacctgagggatcccgggaagcccacgtgaggtgg
gatgcgcctgcgcaccctaacgggcgcttaacctactcagtccatttcaccggaagtttc
tatgcagatcaagcaggtgacaactacacccttctcagtggtacaaaaactatccgcggc
atcgaaggaagccggctctgggtgctggtggacggactggttccttgctcacactacatg
gtacaagtgaatgcttctaacagcagagggagcgtgctcagtgaccctgtttccgttgaa
atgcctcccggggctccagatggcctgctgtctcccaggcttgcagctgccgctccaacc
agtcttcaggttgtctggtctacaccagctcgcaacaacgctccgggctctcccagatac
cagctccagatgaggcctggtccctccactcatggccgtctagaattattccccattcct
tctgcatcgttaagctacgaagtgactggtctccagccgttcacagtgtatgagtttcgg
ttggttgccaccaatggctttggcactgcatacagtgcttggactccgctcatgactaca
gaggacaagcctggacctatagatgctccaattcttatcaatgtgaaagctaggatgttg
tcggtcatctggaggcagcctgcaaagtgcaatggggccattacccattataacatctac
ctgcatggccgtctctacttaacagtctctggacgagtcactaactatactgtggtccct
ctgcatccttacaaggcctatcacttccaggtagaagcctgcacctcccaagggtgctct
aagtcaccatcgtctgagactgtgtggacactcccaggaaatccagaaggcatcccaagc
ccacagttgttcccatacactccaacatcaatcatagtaacttggcaaccctcggcacac
ctggatctcttggttgagaacgttacaatcgagagacgagtcaaagggaaaaaggaagtt
aggaacctggtgaccctggcaagaagtcaagccatgaagtttattgataatgatcctgcc
ctccgcccttggacacgctatgaataccgggttctggggagcactcttgatgggggcaca
aacagcagtgcttgggtagaagtgaccacaagaccctgtcggccttccggagtacagcca
cccacagtgcgtgtgctggcaccagatacagtcgaggtctcttggaaagccccacttatg
cagaacggagatatactgagctatgagatacgaatgccagagcctctcatcaaaatgacc
aatatgagctccatcatgttgagtcatctggtcaagcatctgatccctttcacaaactat
tcagtcaccatcgttgcttgctctggaggtaacgggtacctagcagggtgcacggagagc
ccacccacccttgctactactcacccagccccgcctcaggaactggccccgttgtctgtg
attcttctaagtgaatctgatgttgggatttcttggcagccaccatccaaaccaaatgga
ccaaatttgagatacgagcttctgagatgtaaaatccagcagccacttgcttcaaatccc
ccagaagatttaaatctgtggcacaatatttactcaggaactcggtggttttacaaagat
aagggtcttagcaggttcacaacgtacgaatataagctctttgtacacaacagtgtgggc
tttacaccaagccgagaagtgacagtcaccaccttagcaggctctccagagagaggagcc
acggtcaccgcaagcatccttaatcacacagccatagacgtgagatggaagaaaccaaca
tttcaagatctacaaggtgatgtggaatattacacactgttttggagttctgggacctca
gaggaatctctgaaaatcttcccggatgtagactttcacgtcattggccagttatctcca
aacgtggagtaccaggttttcctcttggttttcaatggagtccacgcaatcaacagcaca
gttgtgcatgtgaccatgtgggaggaggagcctcagggcatgcttcccccagaggttgtc
atcatcaacagtacagctgtacgtgtcatctggacatcgccttcaaacccaaatgccgtt
gtcaccgagtcttctgtctatgtaaataataagctctacaagactggaacggatgcgccc
gggtcgtttgttctggaagacctgtctcccttcactatctatgacattcaggtggaagtc
tgtacaaaagacgcctgcgtgaaaagcaatggaacgcaagtcagcacagcggaagatact
ccaagtgacatttcaatacctgtaatccgaggtattacttcaagatcccttcaaatagat
tggacaacaccagcaaatccaaatggtatcattcttgggtatgacgttttgcggaaaaca
tggcgcccatgctctgaaacccagaagttaacagacaaaccgcgtgatgagctttgcaaa
gcagtcaagtgccaataccctggaaaagtctgtgggcacacgtgctactctccaggaact
aaggtatgttgtgacggacttctgtatgaccctcagcctggatacagctgctgtgaggac
aaatacatcgcactctctccgaatgccactggggtttgctgtggagggcgaatgtgggag
gcacagccagaccaccagtgctgctctgggcattacgctagaatccttccaggagagata
tgctgccccgatgagaggcacaaccgggtgtccgtgggctttggtgatgcctgctgcggc
acaatgccttatgccacctctgggagccaggtgtgctgtgccgggaggctccaggacggc
tatagacagcagtgctgtgggggagagatggtgagccaagatttccagtgctgtggtgga
ggagaagagggcatggtatacagttacctcccaggaatgctgtgttgtgggcaggattat
gtgaatatgtcagagaccatatgctgttcagcttccagtggagagtctaaagcacatgtt
agaaaggatgaccccacaccagtgaaatgctgcggcactgaactgagtccagagagccag
cgatgctgtgatggggttggatataatcctttgaaatatgtttgttctgatgagatttca
gctggaatggcgatgaaggaaaccagagtatgtgcgactatctgcccagcaaccatgaaa
gccacagcacactgtgggaggtgtgacttcaacgccaccacccatatctgcacggtgatg
agagggcctctcaatcccacagggaagaaagcggtggaaggactgtgttctgcagcagag
gaaatagttcattctggagatgtaaacacacactctttcatagatagagacctcaagcca
agcactgtgtatgaatatagaatttctgcatggaacagctacgggcgaggattcagccaa
tccgtgagagctagcacaagagaagatgtgcctgaaggagtcaaggcccctagatgggcc
aggacgggcaaacatgaagatgttattttcttacagtgggaagagcccatgcagtcaaat
ggtcctatcattcactatattctttttcgagacggaagggagcgctttcagggaacagcg
ctgagcttcacggacacgcagggaattcagccactccaggaatactcataccagctgaag
gcttgcacagctgctggttgtgctgtcagttgcaaggtagtcgctgccaccacccaaaga
agcccggagaatgtcccaccaccaaacatcacagcccagagctcagagactctacacctc
agctggagtgtccccgagaaaatgaaagatgccattaaagcataccagctctggctggat
gggaaagggctcatctacaccgacacaagtgacaggaggcagcatacggttacaggtctc
cagccatacacaaactacagcttcacactcgcggtttgtacatctgtcggatgcacttcc
agtgagccctgtgtaggtcagactctgcaggctgcccctcaaggagtttgggtgacaccg
cgacacattatcatcaattctacaaccgtggagctatattggaatcctccagaaaggccc
aacggcctcatttctcaatatcagctgaggcgtaatggaagcttgcttctcgtggggggc
agagataatcagagtttcactgatagcaacctggagcccggcagcaggtacatttacaag
ttggaagcgagaactggaggtggtagcagttggagtgaggactaccttgtccagatgcct
ctgtggaccccagaagacattcatcccccatgtaatgtcactgtgctgggctctgattcc
atatttgtagcatggccaacaccagggaacctgcttcccaaaattccagtcgagtacagc
atcttactcagtggcgggagtgtgacgctcttagtcttctctgtcagacaccggcaatct
gcacacctgaaaaacctgtctccgttcacacagtatgaaatacggatccaagcctgccaa
aatgggggctgtggagtcagccctgggacatacgtcagaacgcttgaagcagcacccgtg
ggtctgatgccccctcttctgaaggctctggggtcatcttgcatagaggttaagtggatg
ccaccaacgagacccaatggaatcatcactagctatgtcgttcacaggcgtcctgctgac
actgaagaagagtctctgctctttgtctggtcagaaggagctctggagtttactgatgat
acaggcactctgcggccttttacactgtatgagtaccgggtgagagcctggaactcccag
ggtgcagtggacagcccgtggtccacaatacagaccctggaagccccacctcgaggcctc
ccagcaccacgggttcaagccaccagtgctcattcagccatgctaaactggacagagcca
gaggcccccaatggcctcatctcccagtaccatgtgatctaccaagaaagaccagatgcg
gcagcacccggcagttctaccgtgcatgctttcacggtgacgggaacgagtcgtcaagcc
catctctttggcttggaaccattcacaacataccacattggtgtggtggctgtaaacagt
gcaggaaaggtgtcgagcccctggaccctgattaagactttagaatctgccccaagcgga
ctgatgaacttcacagtggagcagagagaaaagggccgggctttgctgctgcagtggtca
gagccagtgaagaccaatggagtgatcaaggcatacaacatcttcaatgatggggtcctg
gagtactctggcctgggtcggcagtttctcttcaggcgcctggcccccttcactctctat
accttgatcctggaggcctgcacgacagcaggctgtgctcactcggtgcctcagcctctc
tggacagaggaagcccctccagatactcagatggctcctaccatccagtctgtggggccc
accaatgtaaggctgcactggtctcagccggctagccccaatgggaagataatccattac
gaagtgatccgcagacgctcggaggaagaggactgggggaacacaacatggcaggcagac
gggaacactgttttcacagaatacaacacgcaagggaatgcatgggtgtataatgacacg
ggtctgcagccgtggaggcagtatgcttatagaatctgcgcttggaattctgcagggcac
acctgtagctcttggaatgtggtgagaacattgcaagcacccccagatggcctctctcca
ccagagatatcctatgtgtctatgagtcccctccaactgctgatttcctggcttccaccc
cgacactctaacggtgtcatccagggctacagacttcaaagagatggagtgcttcctgct
ctcaatttcaatgccagcaccttcagctacatggacagccagctgcttcccttctcaacg
tacagttatgccatcctggcctgcacaggtggtggctgctgtaccagtgaacccaccaac
atcaccactcctgaggtacctccatcagaagtcagccctccagttctttgggacatcagt
gcccaccagatgaatgtgtcttggtccccgccatcaatcccaaatggaaagattgttaaa
tatttgcttcaatgcgatggtgaggagcacctggctgggcagggtctgtcctttctgctc
tctaacctgcagccttccactcagtataatatctcccttgtggcctgcacaagtggaggg
tgcactgctagtaggaccacatccgcctggacaaaggaggctccaccagagaacatggac
ccaccaacactgcacatcacaggcccagaatcaatagaaattacatggacacctccaaga
aacccacatggcctgatcagaagttatgagcttcggagagatggagccattgtgtatgta
ggtctggaaactcgctaccatgattttacccttgctcctggtgttgaatacagctactcg
gtgactgccactaacagccggggcagtgtcttgagcccacttgtcaagggtcaaactagc
ccctcagccccctcaggtttacagcccccaaagctgcattcgggggatgctcttgagctc
ttagctgattgggaccctccggtgaggacaaacggcaagatcatcaactacactctcttc
gtccgtgagatgtttgaaggaaaaaccagagccatgtccattaacacaacacacagttct
tttggcacacggtcactcacggtaaagcacctgaagccgtttcataggtatgaagtgcgt
gtccaagcctgcactgccctcgggtgtacctccagtgagtggacatctacccaaacctca
gaggtcccaccactgaggcagccagccccacatctggaggtgcagacagctacaggggga
ttccagcccatagtagccgtgtggtgggcaggaccacttcagccaaatggaaaaatcata
tgctttgaattgtacagaagacaagtagcagcctggcctggcacatccagttcactgcta
atctacaacggcagcttccgctcctttatggactcagagctactaccattcacggaatac
gaataccaggtatgggcggtgaattctgcaggcaaagctgcaagtaactggacacggtgc
agaactggacctgccccaccggaaggtctccaagcgcccacattccacaccgtctcctcc
acccgagcggtggtcaacatcagtgtgccttcgagacccaatgggaacatcagcctcttc
agggtcttctccaactccagcgggacgcacgtcacgctgtctgaaggcaccgccacccag
cagacccttcatgacctgagtcccttcaccacatacaccattggggttgaggcctgcacc
tgcttcaactgctgcagccgaggcccgacagccgagctgaggacccaccctgccccgccc
tcagggctgtctcctccccaggtccagacactgggctccaggatggcctccgtccactgg
actccccccctgctccccaatggtgtcattcacagctatgagctgcagctgcagcgggct
tgccctcctgattcagccccacgctgccctccaagccacacagaaaggaagtactggggc
cctgggcacagagccagcctggcggggcttcagcctaatactgcctacggggtgcaagtg
gtggcatacaatgaagcaggcagcacggcttccgggtggaccaacttcagcaccaagaag
gagatgcctcagtaccaagccctgttctcagtggacagcaacgcatccatggtgtgggtg
gactggagtggcacttttctcctgaacggccatctaaaggagtacgtggtcaccgacgga
ggacggagggtgtacagtggcctagacaccacactctacataccaaggatggtggacaaa
attttcttcttccaggtcacctgcacgaccgacattggaagtgttaagactccactggtc
caatatgatgctgctactggatctggcctggtgctgacaactcctggagaaaagaaggga
gcagggaccaaaagcacagagttctacagtgagctgtggtttattatggtaatggctgtg
gtgggcctgatcttgttggccatttttctgtccttgattctacaaagaaaaatccacaag
gaaccatgtatcagagagcgacctcccttggtacctcttcagaaacgaatgaccccactg
agcgtctacccaccaggggaaacccatgtgggattagccgacaccagactccctaggtct
gggacacctatgagtattcggagcagccaaagtgtgtctgtactgcggatcccaagtcaa
agccaactgagccacgcctactcccagagctctctccaccgcagtgtcagccagctcatg
gacatggcagacaagaaggttgttacggaagactcactgtgggaaactattatgggccac
agcagtggactgtatgtggacgaagaagagctcatgaacgccatcaagggtttcagctcc
gtgaccaaggagcacaccgcctttaccgacacccacctctga

DBGET integrated database retrieval system