KEGG   Mus musculus (house mouse): 22286
Entry
22286             CDS       T01002                                 
Symbol
Utf1, AI505934
Name
(RefSeq) undifferentiated embryonic cell transcription factor 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Myb_DNA-bind_4 Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 22286
NCBI-ProteinID: NP_033508
MGI: 1276125
Ensembl: ENSMUSG00000047751
UniProt: Q6J1H4 B2RSF1
Position
7:139523769..139525025
AA seq 339 aa
MLLRPRRLPAFSPPSPASPDAELRSAGDVPVTTSDAFATSGGMAEPGSPKAPVSPDSAQR
TPWSARETELLLGTLLQPAMWRSLLLDRRQTLPTYRRVSAALARQQVRRTPAQCRRRYKF
LKDKLRDSQGQPSGPFDNQIRQLMGLLGDDGPPRVRRRSTGPGRPQRRGRSSLSALAPAP
APVEQEAELPLAAENDEPAPALRFSSSTTKSAGAHRITSSPPLTSTDTLPPEPGHTFESS
PTPTPDHDVETPNEPPGLSQGRASSPQVAPQSLNTALLQTLTHLGDISTVLGPLRDQLST
LNQHVEHLRGSFDQTVSLAVGFILGSAASERGILGDLRQ
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgctgcttcgtccccggaggttgcccgctttttctccgccgtcgccagctagccccgac
gctgagctgcggtcggccggggatgtcccggtgactacgtctgatgccttcgctacttcg
ggcgggatggctgaacccggctcgcccaaggctcccgtgtccccggactcggcgcagcgc
acgccctggagtgcccgagagacggagctacttctgggcacgctgctgcagccggccatg
tggcgctcactactgctggaccgcaggcagactctgcctacttaccgccgcgtgtccgcc
gcactggcccgtcagcaagttcggcgcacgcccgctcagtgccgccgtcgctacaagttc
ctcaaggacaaactccgagactcccagggccagccgtccggacccttcgataaccagatc
cgccaactcatggggctattgggggacgatgggccgccgagggttcgccgccgctctact
ggccctggacgtccccagcgccgcggccgctcgtccctctccgcgttagcacccgcacct
gcaccggtggagcaagaggccgagctgccgctggctgcggaaaatgacgaacctgcccct
gcgctcagattcagttcttccacgacgaagtctgcaggtgcccaccgcattaccagctct
cctcctcttacgagcaccgacactctgcctcctgagccgggccataccttcgaatcctcc
ccgacgccaacccccgaccacgacgtggagaccccgaatgagcctcctggcctttcccag
ggccgtgcttcttccccgcaggttgctccccagtcgttgaataccgcgttgctgcagacc
ttgacgcacttgggcgacatctcaacagttctgggccctctgcgcgaccagctgtcgacc
ctgaaccagcacgtggagcatctacgaggttccttcgaccaaaccgtttctctggcggtg
gggttcattctgggcagtgcagcctccgagcggggcatccttggggacttgcgccaataa

DBGET integrated database retrieval system