KEGG   Mus musculus (mouse): 22290
Entry
22290             CDS       T01002                                 

Gene name
Uty, Hydb, mKIAA4057
Definition
(RefSeq) ubiquitously transcribed tetratricopeptide repeat containing, Y-linked
  KO
K11447  lysine-specific demethylase 6A [EC:1.14.11.68]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    22290 (Uty)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    22290 (Uty)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.68  [histone H3]-trimethyl-L-lysine27 demethylase
     22290 (Uty)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    MLL3/MLL4 complex
     22290 (Uty)
   Histone demethylases
    22290 (Uty)
SSDB
Motif
Pfam: JmjC TPR_1 TPR_2 TPR_8 TPR_12 TPR_16 TPR_17 TPR_19 TPR_9 TPR_11 SNAP
Other DBs
NCBI-GeneID: 22290
NCBI-ProteinID: NP_001313611
MGI: 894810
Ensembl: ENSMUSG00000068457
Vega: OTTMUSG00000032814
UniProt: Q3UQE8 E9PWW8
Position
Y; Ypter
AA seq 1211 aa
MKSYGLSLTTAALGNEEKKMAAEKARGEGEEGSFSLTVEEKKALCGLDSFFGFLTRCKDG
AKMKTLLNKAIHFYESLIVKAEGKVESDFFCQLGHFNLLLEDYSKALSSYQRYYSLQTDY
WKNAAFLYGLGLVYFYYNAFQWAIRAFQEVLYVDPNFCRAKEIHLRLGFMFKMNTDYESS
LKHFQLALIDCNVCTLSSVEIQFHIAHLYETQRKYHSAKAAYEQLLQIESLPSQVKATVL
QQLGWMHHNMDLIGDNTTKERYAIQYLQKSLEEDPNSGQSWYFLGRCYSCIGKVQDAFVS
YRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGILYESCN
QPQDAIKCYLNAARSKSCNNTSALTSRIKFLQAQLCNLPQSSLQNKTKLLPSIEEAWSLP
IPAELTSRQGAMNTAQQSVSDTWNSVQTASHHSVQQKVYTQCFTAQKLQSFGKDQQPPFQ
TGSTRYLQAASTNDQNQNGNHTLPQNSKGDAQNHFLRIPTSEEQKIINFTKESKDSRSKS
LTSKTSRKDRDTSNICVNAKKHSNHIYQISSVPISSLNNKESVSPDLIIVDNPQLSVLVG
ETIDNVDHDIGTCDKVNNVHLAIHKKPDNLSASSPSSAISTETLSLKLTEQTHIVTSFIS
PHSGLHTINGEGHENLESSASVNVGLRPRSQIIPSMSVSIYSSSTEVLKACRSLGKNGLS
NGHILLDICPPPRPPTSPYPPLPKEKLNPPTPSIYLENKRDAFFPPLHQFCINPKNPVTV
IRGLAGALKLDLGLFSTKTLVEANNEHIVEVRTQLLQPADENWDPSGTKKIWRYENKSSH
TTIAKYAQYQACSFQESLREENERRTQVKDYSDNESTCSDNSGRRQKAPFKTIKCGINID
LSDNKKWKLQLHELTKLPAFVRVVSAGNLLSHVGYTILGMNSVQLCMKVPGSRIPGHQEN
NNFCSVNINIGPGDCEWFVVPEDYWGVLNDFCEKNNLNFLMSSWWPNLEDLYEANVPVYR
FIQRPGDLVWINAGTVHWVQAIGWCNNITWNVGPLTAFQYKLAVERYEWNKLQSVKSVVP
MVHLSWNMARNIKVSDPKLFEMIKYCLLKILKHCQTLREALVAAGKEVLWHGRINDEPAP
YCSICEVEVFNLLFVTNESNSQKTYIVHCQNCARKTSGNLENFVVLEQYKMEDLIQVYDQ
FTLAPSLSSAS
NT seq 3636 nt   +upstreamnt  +downstreamnt
atgaaatcttacggattatctctcactactgctgccctaggtaatgaggaaaagaaaatg
gcggcggaaaaggctagaggcgagggcgaagaggggtccttcagtctcacagtcgaagag
aagaaggcgctttgtggattagatagcttcttcgggttcttgacccgatgcaaagatggc
gccaagatgaagacgctgttgaacaaggcaattcacttctatgagtctttaatagtaaaa
gctgaaggaaaagtggaatcagatttcttttgtcaattaggtcacttcaatctcttactg
gaagattattcaaaagcattgtcatcttaccagagatactacagtttacagactgactac
tggaagaatgctgcctttttatatggtcttggtttggtctatttctactacaatgcattt
cagtgggcaattagagcttttcaggaagtcctttatgttgaccctaatttttgcagagcc
aaagaaatccatttacgacttggttttatgttcaaaatgaatacagattatgaatctagt
ttaaagcattttcagctggccctgatcgactgtaatgtctgtactttgtccagtgtcgaa
attcagtttcatattgctcacttatatgaaacccagaggaaataccattctgcaaaggca
gcctatgaacaacttttacagattgaaagcttgccatcacaagtcaaagcaactgtattg
caacagttaggttggatgcaccataatatggatctaattggagacaataccaccaaagag
agatatgctattcagtatctccaaaagtcattggaggaagatcctaattctggtcaatct
tggtatttccttggaaggtgttactcatgtattgggaaggttcaggatgcctttgtatct
tacaggcaatccattgataaatcagaagcaagtgcagacacatggtgttcaataggtgtg
ctgtatcaacagcaaaatcaacctatggatgccttgcaagcctatatatgtgctgtacag
ttggatcatggacatgcagcagcctggatggacttaggtattctttatgaatcttgcaac
caaccccaggatgccattaaatgctacttaaatgcagctcggagcaaatcttgtaataac
acctctgcacttacatcaagaattaagtttttacaggctcagttgtgtaaccttccacaa
agtagtctacagaataaaactaaattacttcctagtattgaggaggcatggagcctacca
atacccgcagagcttacctccaggcagggtgccatgaacacagcacagcagagtgtttct
gatacctggaatagtgtccagacagcttcacatcattcagtacagcagaaagtttataca
cagtgcttcacagcacagaaattacagagttttggtaaagatcaacaacctccatttcaa
actgggtccacacgatatctccaagcagctagcactaatgatcagaatcagaatggaaat
catactctgcctcagaattcaaaaggggatgctcaaaatcacttcttacgtattcctacc
tcagaagaacaaaagatcattaactttaccaaagagagcaaggattcaagaagtaaatcc
ttgacttctaaaacaagtaggaaagatagagacacatctaatatctgtgttaatgcaaag
aagcattctaatcatatttatcagatctcatcagttccgatttccagccttaataataaa
gaatctgtgtcaccagatttaataattgtagacaatcctcagctttctgtcttagttgga
gaaactatcgacaatgtggaccatgacattggaacttgtgacaaagtcaataatgttcat
ctagccattcacaaaaagcctgataatctttctgcttcttcaccctcttcagccatttcc
acagaaacactttctctaaagctcactgaacagacacacattgttaccagctttatcagt
cctcacagtggattacacacaattaatggagaagggcatgagaacttagagagttctgcc
agtgttaatgttggcctcagacctagatctcaaatcataccatcaatgtctgtgtccata
tactccagttcaacagaagttctgaaagcgtgcaggagtctaggtaaaaatggtttgtct
aatggtcatattctcttggatatatgcccacctccaagaccaccaacttcgccatatcct
cctttaccaaaggagaagttgaatccacccactcctagtatttatttggaaaataagcga
gatgccttttttcctccattacatcaattttgcatcaatccaaaaaaccctgttacagta
attcgcggtcttgctggagctcttaagttagatcttggacttttctctaccaaaactttg
gtagaggctaacaatgaacatatcgtagaagtgaggacccaattgttacagccagcagat
gaaaactgggatccctctggaacaaagaaaatctggcgatatgaaaataaaagttctcat
actacaattgctaaatatgcacagtaccaggcctgctccttccaggaatcattgagagaa
gaaaatgaaagaagaacacaagttaaagactattcagataatgaatcaacatgttcagat
aattctggaaggagacagaaagcaccctttaaaaccataaaatgtgggattaacattgat
ctgtctgataacaaaaagtggaagttgcagttacatgagctgacaaagcttcctgctttt
gtacgtgttgtatcagcagggaatcttctcagtcatgttggctatactatattggggatg
aattcagttcaactatgtatgaaagttccagggagtagaataccaggtcaccaagaaaat
aacaatttctgttctgttaacataaatattggtccaggtgattgtgaatggtttgttgta
cctgaagattattggggtgttctgaatgacttctgtgaaaaaaataatttgaatttcctg
atgagttcttggtggccgaaccttgaagatctttatgaagcaaatgttcctgtttatagg
tttattcaacgacctggtgatttggtttggataaatgcaggcactgttcactgggttcag
gctattgggtggtgtaacaacatcacctggaatgttggtccactcacagccttccaatat
aaattggcagttgaacgatatgaatggaataaattgcaaagtgtcaagtcagtagtaccc
atggttcatctttcatggaatatggcacgaaatatcaaagtctcagatccaaagcttttt
gaaatgattaaatattgtctcctcaagattctaaagcattgtcagactttgagagaagct
cttgttgcagcagggaaagaggttttgtggcatgggaggataaatgatgaaccagctcct
tactgtagcatctgtgaggtggaagtttttaatttactttttgtcactaatgaaagcaat
tctcaaaagacatatatagtacattgtcagaactgtgcacgaaaaacaagtggaaatttg
gaaaattttgtagtgctagaacaatacaaaatggaggacctgattcaagtctatgaccaa
tttacattagctccttcgttatcttctgcatcttaa

DBGET integrated database retrieval system