KEGG   Mus musculus (mouse): 22312
Entry
22312             CDS       T01002                                 

Gene name
Vmn2r107, V2, V2r6, Vmn107
Definition
(RefSeq) vomeronasal 2, receptor 107
  KO
K04613  vomeronasal 2 receptor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    22312 (Vmn2r107)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    22312 (Vmn2r107)
SSDB
Motif
Pfam: 7tm_3 ANF_receptor NCD3G
Other DBs
NCBI-GeneID: 22312
NCBI-ProteinID: NP_001098039
MGI: 1316664
Ensembl: ENSMUSG00000056910
Vega: OTTMUSG00000039776
UniProt: E9PZJ7
Position
17; 17 A3.2
AA seq 861 aa
MFSWIFIFLLLQIPKFVSSDLKFNVNRCYFEITEEFHHEGDVMIGAFFPVHTFYTEKKRP
HSTIPYQYLDGYIQYNFKNYQYILALLFAIEEINGNPNLLPNISLGFDFYNVRFTEKETL
MNTVIWLTAHVQRKVLPNYNCKKSNFTAAITGTSWITSAQIGTLLQLFKFPQITFGPYDP
FLSDRGQYPSLYQMAPKDTSLSLAIVSLMVHFRWSWVGLILPDDHKGNKILSDFRKEMER
KRICTAFVKMIPATWTSSFVKFWENMDDTNIIIIYGDIDSLEGLMRNIGQRLLTWHVWVM
NIEPHIIEYDNYFMLDSFHGSLIFKHNYRENFEFTKFIRTVNPKKYPEDIYLPKMWYLFF
MCSFSDINCQVLDSCQTNASLDMLPSQIFDVVMSEESTSIYNAVYAVAHSLHEMRLQQLQ
TQPCENEEGMEFFPWQLNTFLKDIEVRVNSLDWRQRIDAEYDILNLWNLPKGLGLKVKIG
NFYANAPQGQQLSLSEQMIQWPEIFSEIPQSVCSESCGPGFRKVTLENKAICCYNCTPCA
DNEISNETDVDQCVKCPESHYANTEKSNCYQKSVSFLGYEDPLGMALASIALCLSALTAF
VIGIFVKHKDTPIVKANNQALSYTLLITLKFCFLCSLNFIGQPNTVACILQQTTFAVAFT
MALATVLAKAITVVLAFKVSFPGRMVRWLMISRGPNYIIPICTLIQLLLCGIWMAISPPY
IDQDAHIEHGHIIILCNKGSAVAFHSVLGYLCFLALGSYTMAFLSRNLPDTFNESKFISL
SMLVFFCVWITFLPVYHSTKGKVMVAMEVFSILASSTALLAFIFGPKCYIILLRPEKNSF
HHIREKRTTHSRRKIFFLKYS
NT seq 2586 nt   +upstreamnt  +downstreamnt
atgttctcctggatttttatcttcttgctcttgcaaattcccaaatttgtctcttctgat
ttaaagtttaatgtcaatagatgttatttcgaaatcactgaagagtttcaccatgaagga
gatgttatgattggtgcctttttccctgttcatactttctacactgaaaagaaaaggcct
cattcaactataccataccaatatttggacggttatatacagtataactttaagaactac
caatatattctggctctgctatttgccattgaggagatcaatgggaatcccaatctttta
cccaacatatctcttggatttgatttctacaatgtcagattcactgaaaaggaaacactt
atgaatactgttatttggctcacagctcatgtgcagagaaaggttttacctaattacaat
tgtaaaaagagtaatttcactgctgcaatcacaggaacatcatggataacttctgcccaa
attgggacattgcttcaactctttaaatttccacagattacttttggaccttatgatcct
ttcttgagtgaccgtggtcagtatccttctctctaccagatggctcccaaggacacatct
ctttcacttgccattgtttctttgatggttcattttaggtggtcttgggttggtctaatt
ctcccagatgaccacaaaggaaataaaatactatcagattttagaaaggagatggagaga
aaaagaatctgtacggcttttgtaaaaatgattcctgccacatggacttcatcttttgtc
aaattctgggaaaatatggatgacaccaacataataattatttatggtgacattgattct
ctagaaggtctaatgcgaaatattgggcaaaggttattgacatggcatgtctgggtcatg
aacattgaaccccatattattgaatatgataattatttcatgttagattcattccatgga
agtttaatttttaagcacaattatagagagaattttgagtttaccaaatttattcgaaca
gttaatcctaaaaaatacccagaagacatttatctccctaagatgtggtatttgttcttc
atgtgctcattttctgatattaattgtcaagttttggacagctgtcaaacaaatgcttct
ttggatatgttacctagtcagatatttgatgtggtcatgagtgaagagagcacaagtatt
tacaatgctgtgtacgctgtggctcacagcctccatgagatgagacttcagcaacttcaa
acacaaccgtgtgaaaatgaagaagggatggagttctttccatggcagcttaatactttc
ctgaaggatattgaggtgagagtcaacagtttagactggagacagagaatagatgctgaa
tatgacattcttaacctctggaatttaccaaagggtcttggactaaaagtgaaaatagga
aacttttatgcaaatgctccccagggtcaacaattgtctttatctgaacagatgattcaa
tggccagaaatattttcagagatccctcagtcggtgtgcagtgagagttgtgggcctgga
ttcaggaaagtaaccctggagaataaggctatctgctgctacaattgtactccctgtgca
gacaatgagatttctaatgagacagatgtagaccagtgtgtgaagtgtccagagagtcat
tatgcaaatacagagaagagcaactgctatcaaaagtctgtgagctttctgggctatgaa
gaccctttggggatggctctagccagcatagctttgtgcttatctgcactaactgccttt
gttattggcatatttgtgaaacacaaagacactcctattgttaaggccaataatcaagct
ctgagttacactttgctcatcacactcaaattctgtttcctatgttctttgaacttcatt
ggtcagcccaacacagttgcctgcatccttcagcagaccacctttgcagttgctttcact
atggctcttgccactgtgttggccaaagctatcactgtggttcttgcctttaaggtcagt
tttccagggagaatggtaaggtggctaatgatatcaaggggtccaaactatatcattcct
atctgcaccctgatccaacttcttctttgtggaatatggatggcaatatctccaccatac
attgaccaagatgctcatattgaacatggtcacatcatcattttgtgcaacaagggctca
gctgttgccttccactctgtcctgggatacctctgcttcttggcccttgggagttatacc
atggccttcttgtcaagaaatttgcctgatacattcaacgaatccaaatttatctcacta
agtatgctggtattcttctgtgtctggatcacctttcttcctgtctaccacagcactaaa
gggaaggtcatggtagctatggaagtattctctatcttggcttccagcacagcactcctc
gccttcatatttggtcccaagtgttatattatcttgttgagaccagagaagaattcattt
catcacatcagggaaaaaagaacaacacattctagaaggaagatttttttcctaaaatat
agttga

DBGET integrated database retrieval system