KEGG   Mus musculus (mouse): 22318Help
Entry
22318             CDS       T01002                                 

Gene name
Vamp2, Syb-2, Syb2, Vamp-2, sybII
Definition
(RefSeq) vesicle-associated membrane protein 2
  KO
K13504  vesicle-associated membrane protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04130  SNARE interactions in vesicular transport
mmu04721  Synaptic vesicle cycle
mmu04911  Insulin secretion
mmu04962  Vasopressin-regulated water reabsorption
mmu04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    22318 (Vamp2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    22318 (Vamp2)
  09154 Digestive system
   04970 Salivary secretion
    22318 (Vamp2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    22318 (Vamp2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    22318 (Vamp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    22318 (Vamp2)
Membrane trafficking [BR:mmu04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    22318 (Vamp2)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    22318 (Vamp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synaptobrevin MCU Orf78 PRIMA1 LMBR1 MgtE Tweety Ferlin_C DUF2207 DUF2970 CD34_antigen
Motif
Other DBs
NCBI-GeneID: 22318
NCBI-ProteinID: NP_033523
MGI: 1313277
Ensembl: ENSMUSG00000020894
Vega: OTTMUSG00000005972
UniProt: P63044 Q8CHR4
Position
11; 11 B3
AA seq 116 aa AA seqDB search
MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL
SELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctaccgctgccaccgtcccgcctgccgccccggccggcgagggtggcccccct
gcacctcctccaaaccttactagtaacaggagactgcagcagacccaggcccaggtggat
gaggtggtggacatcatgagggtgaatgtggacaaggtcctggagcgggaccagaagttg
tcggagctggatgaccgtgcagatgccctccaggcaggggcctcccagtttgaaacaagt
gcagccaagctcaagcgcaaatactggtggaaaaacctcaagatgatgatcatcttggga
gtgatctgcgccatcatcctcatcatcatcatcgtttacttcagcacttaa

DBGET integrated database retrieval system