KEGG   Mus musculus (mouse): 22321
Entry
22321             CDS       T01002                                 

Gene name
Vars, Bat, Bat-, Bat6, D17H6S56, D17H6S56E, G7, G7a, V, Vars1, Vars2
Definition
(RefSeq) valyl-tRNA synthetase
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    22321 (Vars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    22321 (Vars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    22321 (Vars)
Enzymes [BR:mmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     22321 (Vars)
Amino acid related enzymes [BR:mmu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   22321 (Vars)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    22321 (Vars)
 Prokaryotic type
    22321 (Vars)
SSDB
Motif
Pfam: tRNA-synt_1 Anticodon_1 GST_C tRNA-synt_1g tRNA-synt_1_2 Val_tRNA-synt_C GST_C_2 Jag_N tRNA-synt_1e
Other DBs
NCBI-GeneID: 22321
NCBI-ProteinID: NP_035820
MGI: 90675
Ensembl: ENSMUSG00000007029
Vega: OTTMUSG00000037142
UniProt: Q9Z1Q9 Q790I0
Position
17 B1; 17 18.54 cM
AA seq 1263 aa
MSILYVSPHPDAFPSLRALIAARYGEAGDGPGWGGPHPRICLQPPPSSRTPFPPPRLPAL
EQGPGGLWVWGAPAVAQLLWPAGLGGPGGSRAAVLVQQWVSYADTELIPAACGATLPALG
LRGPGQDPQAALGALGKALNPLEDWLRLHTYLAGDAPTLADLAAVTALLLPFRYVLDPSA
RRIWGNVTRWFNTCVRQPEFRAVLGEVALYSGARSVTQQPGSEVIAPQKTPAQLKKEAKK
REKLEKFQQKQKTQQQPPHGEKKPKPEKKEKRDPGVITYDLPTPPGEKKDVSGAMPDSYS
PQYVEAAWYPWWERQGFFKPEYGRPSVSAPNPRGVFMMCIPPPNVTGSLHLGHALTNAIQ
DSLTRWHRMRGETTLWNPGCDHAGIATQVVVEKKLWKERGLNRHQLGREAFLEEVWKWKA
EKGDRIYHQLKKLGSSLDWDRACFTMDPKLSATVTEAFVRLHEEGVIYRSTRLVNWSCTL
NSAISDIEVDKKELTGRTLLPVPGYKEKVEFGVLVSFAYKVQGSDSDEEVVVATTRIETM
LGDVAVAVHPKDPRYQHLKGKCVVHPFLSRSLPIVFDDFVDMEFGTGAVKITPAHDQNDY
EVGQRHRLEAISIMDSKGALINVPPPFLGLPRFEARKAVLAALKERGLFRGVKDNPMVVP
LCNRSKDVVEPLLRPQWYVRCGEMAQAASAAVTRGDLRILPEAHQRTWHSWMDNIRDWCI
SRQLWWGHRIPAYFITVHDPAVPPGEDPDGRYWVSGRTEAEAREKAAREFGVSPDKISLQ
QDEDVLDTWFSSGLFPFSIFGWPNQSEDLSVFYPGTLLETGHDILFFWVARMVMLGLKLT
GKLPFREVYLHAIVRDAHGRKMSKSLGNVIDPLDVIHGVSLQGLYDQLLNSNLDPSEVEK
AKEGQKADFPAGIPECGTDALRFGLCAYTSQGRDINLDVNRILGYRHFCNKLWNATKFAL
RGLGKGFVPSATSKPEGHESLVDRWIRSRLTEAVRLSNEGFQAYDFPAITTAQYSFWLYE
LCDVYLECLKPVLNGVDQVAAECARQTLYTCLDVGLRLLSPFMPFVTEELFQRLPRRTPK
APASLCVTPYPEPSECSWKDPEAEAALELALSITRAVRSLRADYNLTRTRPDCFLEVADE
ATGALASAVSGYVQALASAGVVAVLALGAPAPQGCAVAVASDRCSIHLQLQGLVDPAREL
GKLQAKRSEAQRQAQRLQERRAASSYSAKVPLEVQEADEAKLQQTEAELRKVDEAIALFQ
KML
NT seq 3792 nt   +upstreamnt  +downstreamnt
atgtccatcctctacgtctctcctcaccccgacgccttccccagcctccgagccctcatc
gctgcccgatacggggaagctggtgacggtcccgggtggggaggccctcacccccgcatc
tgcttgcagcctcccccgagcagccggactccattccctccgcctcgcctgcccgccctg
gagcagggacctggcggcctgtgggtgtggggggccccggctgtagctcagctgttgtgg
cctgcaggcctggggggacccgggggcagccgggcagctgtcctggtccagcagtgggtc
agttatgctgacacggagctcatacccgctgcctgcggggcgaccctgcctgccctggga
cttcgaggtcctggtcaggatccccaggctgcccttggggccctgggcaaggccttgaac
cccttggaggactggctgcggctgcacacctacctggctggagatgcccccactctggct
gacttagctgctgtgacagccttactgctgcctttccgatacgttctggacccttctgcc
cgccggatctggggcaatgtgactcgctggtttaacacttgtgtccggcaaccggaattc
cgggctgtgctgggagaagtggccctgtactcgggggccaggtctgtcactcaacagcca
ggctctgaggtcatcgcaccccaaaaaacacccgcgcagctcaaaaaagaggcaaagaaa
cgggagaaactagagaaattccagcagaagcagaagacccagcagcagcccccgcacgga
gagaagaaaccaaaaccagagaagaaggagaaacgggaccctggggtcattacctatgac
ctccctaccccaccgggggagaagaaagatgtaagtggcgccatgcccgactcctacagc
cctcagtatgtggaggctgcctggtatccatggtgggagcggcagggcttcttcaagcca
gagtacgggcgtcctagtgtgtcagcaccaaatccccggggtgtcttcatgatgtgcatc
ccaccccccaacgtgacaggctccctgcacctgggccacgcactcaccaacgccatccag
gactccctgactcgatggcaccgcatgcgtggggagaccaccctatggaacccaggctgt
gaccatgcaggcattgccacccaggtggtggtggaaaagaagctctggaaagagcggggt
ctgaaccggcaccagctgggccgcgaggcctttcttgaggaggtctggaagtggaaagcc
gagaagggtgacaggatttaccaccaattaaagaaacttggcagctccttggactgggat
cgagcctgcttcaccatggatcctaaattgtcagcaactgtgacagaggcctttgttagg
ctccacgaagaaggggtcatctaccgtagcacccgcctggtcaactggtcctgcaccctc
aactcagccatttctgacattgaggtggataagaaggagctgacaggccgcaccctgctt
cctgtgcctggctacaaggagaaggtggagtttggggtccttgtgtcctttgcctacaag
gtccaaggctcagacagcgacgaggaggtggtggtggcaacaacccggattgagaccatg
ctgggagacgtggctgtagctgtgcaccccaaggatcccagataccagcacttaaaggga
aagtgtgtcgtccacccattcttgtcccggagccttcccatcgtcttcgatgactttgta
gacatggagtttggcacaggtgccgtgaagatcaccccggcacatgaccaaaatgactat
gaggttgggcagcgacacaggctcgaggccattagcatcatggactcaaagggggccctc
atcaatgtgcctccacctttcctgggcctgcccaggtttgaggccaggaaggctgtgctg
gcggcactgaaggagcggggcctgttccgtggagtcaaggacaaccccatggtggtgccg
ctttgcaaccgctccaaggatgtggtggagcctctgttaaggccacaatggtacgtgcgc
tgtggggagatggctcaggctgccagtgctgctgtgacccggggtgacctccgtatactg
cctgaggcccatcaacggacgtggcattcttggatggacaacatcagagactggtgcatc
tctcggcagctgtggtggggccaccgaatccctgcctactttatcaccgtccatgacccg
gcagtaccccctggggaggaccctgatgggcggtactgggtaagcggacgcactgaagca
gaggcccgagagaaggcagcacgggagtttggagtgtcccctgacaagatcagccttcag
caagatgaggatgtgttggacacctggttctcctccggtctctttcccttctccatcttt
ggctggcccaatcagtcagaagacctcagtgtgttctaccctgggaccctgttggagaca
ggccatgatatcctcttcttctgggtggcccggatggtcatgctcggcctgaagctcact
gggaagctgcccttcagagaggtctatctccatgcaatcgtgcgtgatgctcatggcagg
aagatgagcaagtctcttggcaatgtcatcgaccccctggatgtcatccatggagtttcc
ttgcagggcctctatgaccaactactgaacagcaacctggatcccagtgaggtggagaaa
gccaaagaaggacagaaggccgactttccagcagggattcccgagtgtggcactgatgcc
ctacgctttggactctgtgcctacacatcccaaggtcgagacatcaacctggatgtgaac
aggatcctggggtaccgtcacttctgcaacaaactctggaatgctaccaagtttgccctg
cgcggccttgggaagggctttgtgccctcagcaacctccaagcctgaagggcacgagagc
ctggtggaccgctggatccgcagccgcctaactgaggccgtgaggctcagcaatgaaggc
ttccaggcttacgatttcccggccatcaccaccgcccagtacagcttttggctctatgag
ctctgtgatgtctatttggagtgtctaaaacctgtgctgaatggagtggaccaggtggcg
gcagagtgtgctcggcagaccctctacacctgcctggatgttggcctgcggctgctctcg
cccttcatgccctttgtcacagaggagctattccagagactgccccggcggacaccaaaa
gcgcctgctagcctctgtgtcaccccgtacccagagccctcagagtgctcctggaaggac
cctgaagctgaagctgctcttgaactagctctgagcatcactcgagctgtgcgctccctg
cgtgctgactacaacctgacccgcaccaggcccgactgtttcttggaagtagccgatgag
gccacaggtgccttggcctcggcagtgtcgggctacgtgcaggctctggccagtgcgggc
gtggtggctgtcctcgccctgggtgctcctgcaccgcagggctgcgctgtagctgtggct
tctgaccgctgctccatccacctgcagctgcaggggctagtggacccagcccgggagttg
ggcaagctgcaggccaagcgaagtgaggcacagcggcaggctcagcggctgcaggagcgc
cgtgctgcctccagctactcagcaaaggtgccccttgaggtccaggaggcagatgaagcg
aagttgcaacagacagaggcggagctcaggaaggtggatgaggccatcgccctgttccag
aagatgctgtga

DBGET integrated database retrieval system