KEGG   Mus musculus (mouse): 22323
Entry
22323             CDS       T01002                                 

Gene name
Vasp
Definition
(RefSeq) vasodilator-stimulated phosphoprotein
  KO
K06274  vasodilator-stimulated phosphoprotein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04510  Focal adhesion
mmu04530  Tight junction
mmu04611  Platelet activation
mmu04666  Fc gamma R-mediated phagocytosis
mmu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    22323 (Vasp)
   04022 cGMP-PKG signaling pathway
    22323 (Vasp)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22323 (Vasp)
   04530 Tight junction
    22323 (Vasp)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    22323 (Vasp)
   04666 Fc gamma R-mediated phagocytosis
    22323 (Vasp)
   04670 Leukocyte transendothelial migration
    22323 (Vasp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    22323 (Vasp)
   04147 Exosome [BR:mmu04147]
    22323 (Vasp)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     22323 (Vasp)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   22323 (Vasp)
SSDB
Motif
Pfam: WH1 VASP_tetra ASD2 Ran_BP1 SR-25
Other DBs
NCBI-GeneID: 22323
NCBI-ProteinID: NP_033525
MGI: 109268
Ensembl: ENSMUSG00000030403
Vega: OTTMUSG00000024627
UniProt: P70460
Structure
PDB: 
2V8C

Position
7; 7 A3
AA seq 375 aa
MSETVICSSRATVMLYDDSNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQV
VINCAIIRGVKYNQATPIFHQWRDARQVWGLNFGSKEDAIQFATGMANALEALEGGGPPP
APAPPAWSAQNGPSPEELEQQKRQPEHMERRVSNAGGPPAPPAGGPPPPPGPPPPPGPPP
PPGLPSSGVSGAGHGAGAAPPPAPPLPTAQGPNSGGSGAPGLAAAIAGAKLRKVSKQEEA
SGGPLAPKAENSRSTGGGLMEEMNAMLARRRKATQVGEKPPKDESASEESEARLPAQSEP
VRRPWEKNSTTLPRMKSSSSVTTSEAHPSTPCSSDDSDLERVKQELLEEVRKELQKMKEE
IIEVFVQELRKRGSP
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgagcgagacggtcatctgttccagccgggctactgtgatgctttatgatgacagcaac
aagcgatggctccctgctggcactggtccccaggccttcagccgcgtccagatctaccac
aaccccactgctaactccttccgagttgttggccgcaagatgcagccggatcagcaggtg
gttatcaactgtgccatcattcggggtgtcaagtacaatcaggccactcccatcttccat
cagtggcgagatgcccgccaggtctggggcctcaacttcggcagcaaggaggacgccata
cagtttgcaacaggcatggccaacgccctagaggccttggaaggaggtgggcctccccca
gccccagcaccccctgcctggtctgcccagaatggtccctccccagaggagctggaacaa
cagaaaaggcagccggagcatatggagcgccgggtctccaatgcaggaggcccacctgct
cccccagctgggggccctcctccacctccaggacctccccctcctccaggtcccccccca
cccccaggtctgccctcctcaggggtatctggggcaggtcatggagcaggggcagcccca
ccccctgcacccccactccctacagcacagggccccaatagtgggggttccggggcccca
ggcctggctgctgccattgctggagccaaactcaggaaagtgagcaagcaggaggaggcc
tctggggggcccctggcccccaaagctgagaacagtcgaagcactggtggggggcttatg
gaagagatgaacgccatgctggcccggagaagaaaagccacacaggttggggagaagccc
cccaaagacgagtcagccagtgaggagtcagaggcccgactccctgcccagagtgaacct
gtgagaagaccctgggagaagaacagcacaaccttgccaaggatgaagtcgtcctcttct
gtgactacctccgaggcccacccctcgacgccctgctccagtgatgactccgacttggag
agggtgaagcaggagcttctggaagaggtgcggaaggagctacagaaaatgaaagaggaa
atcatcgaagtctttgtccaggagctgaggaagcggggttctccttga

DBGET integrated database retrieval system