KEGG   Mus musculus (house mouse): 22324
Entry
22324             CDS       T01002                                 
Symbol
Vav1, Vav, vav-T
Name
(RefSeq) vav 1 oncogene
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04510  Focal adhesion
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05135  Yersinia infection
mmu05205  Proteoglycans in cancer
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    22324 (Vav1)
   04024 cAMP signaling pathway
    22324 (Vav1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22324 (Vav1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    22324 (Vav1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    22324 (Vav1)
   04660 T cell receptor signaling pathway
    22324 (Vav1)
   04662 B cell receptor signaling pathway
    22324 (Vav1)
   04664 Fc epsilon RI signaling pathway
    22324 (Vav1)
   04666 Fc gamma R-mediated phagocytosis
    22324 (Vav1)
   04670 Leukocyte transendothelial migration
    22324 (Vav1)
   04062 Chemokine signaling pathway
    22324 (Vav1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    22324 (Vav1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    22324 (Vav1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    22324 (Vav1)
SSDB
Motif
Pfam: RhoGEF SH3_1 SH3_2 CAMSAP_CH CH SH3_9 SH2 C1_1 PH CDC24 LZ3wCH C1_2 PH_16
Other DBs
NCBI-GeneID: 22324
NCBI-ProteinID: NP_035821
MGI: 98923
Ensembl: ENSMUSG00000034116
UniProt: P27870 Q3U9E2
Structure
Position
17:57586080..57636236
AA seq 845 aa
MELWRQCTHWLIQCRVLPPSHRVTWEGAQVCELAQALRDGVLLCQLLNNLLPQAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNKGIMPFPTEDSALNDEDIYSGLSDQIDDTAEEDEDLYDCVENEEAEGDEIYEDLMRL
ESVPTPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPQDMETIFVNI
EELFSVHTHFLKELKDALAGPGATTLYQVFIKYKERFLVYGRYCSQVESASKHLDQVATA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDATEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLANYGRPKIDGELKITSVERRSKT
DRYAFLLDKALLICKRRGDSYDLKASVNLHSFQVRDDSSGERDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCYRCRAPAHKECLGRVPPCGRHGQDFAGTMKKDKLHRRAQDKKRNELGLPKMEVF
QEYYGIPPPPGAFGPFLRLNPGDIVELTKAEAEHNWWEGRNTATNEVGWFPCNRVHPYVH
GPPQDLSVHLWYAGPMERAGAEGILTNRSDGTYLVRQRVKDTAEFAISIKYNVEVKHIKI
MTSEGLYRITEKKAFRGLLELVEFYQQNSLKDCFKSLDTTLQFPYKEPERRAISKPPAGS
TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRIGWFPSNYVEED
YSEYC
NT seq 2538 nt   +upstreamnt  +downstreamnt
atggagctctggcgacagtgcacccactggctgatccagtgtcgggtgctgcctcccagc
caccgtgtgacctgggagggggcccaggtgtgtgagctggcacaggcactgcgggacggt
gtcctcttgtgccaattgcttaacaacctgcttccccaggccattaatcttcgcgaggtt
aacttgcggccccagatgtcccagttcctttgtcttaagaacattcgaaccttcctgtct
acttgctgtgagaagttcggcctcaagcgcagtgaactctttgaggcttttgacctcttc
gatgtgcaggactttggaaaggtcatctacaccctgtctgctctgtcatggacacccatt
gcccagaacaaaggaatcatgcccttcccaacagaggacagcgctctgaacgacgaagat
atttacagtggcctttcagaccagattgatgacaccgcagaggaagacgaggacctttat
gactgcgtggaaaatgaggaggcagagggggacgagatctacgaggacctaatgcgcttg
gagtcggtgcctacgccacccaagatgacagagtatgataagcgctgctgctgcctgcgg
gagatccagcagacggaggagaagtatacagacacactgggctccatccagcagcacttc
atgaagcctctgcagcgattccttaagcctcaagacatggagaccatctttgtcaacatt
gaggagctgttctctgtgcatacccacttcttaaaggaactgaaggatgccctggctggc
ccgggagcaacaacactgtatcaggtcttcatcaagtacaaggagaggttcctggtttat
ggccgttattgcagtcaggtggagtcagccagcaagcacttggatcaagtggccacagca
cgggaggatgtgcagatgaagctggaggaatgttctcaaagagctaacaatggccgattc
accctacgggatctgctgatggtacctatgcagcgggtgctgaagtaccacctccttctc
caggagctagtgaaacacacacaggatgctacagagaaggagaacctgcggttggccctg
gacgccatgagggacctggcacagtgcgtgaacgaggtcaagagggacaatgaaacccta
cggcagatcacaaactttcagctgtccattgagaacctggaccagtctctggctaactat
ggccggcccaagattgacggtgagctcaagattacctcagtggagcgtcgctcaaagaca
gacaggtatgccttcctgctggacaaagcactgctcatctgtaaacgccgcggggactct
tacgacctcaaagcctcggtgaacttgcacagcttccaagttcgagatgactcctccggg
gagcgagacaacaagaagtggagccatatgttccttctgattgaggatcaaggcgcccag
ggctatgagctgttcttcaagactcgggagctgaagaagaagtggatggaacagttcgaa
atggccatctccaacatttacccagagaatgctacagccaatgggcatgattttcagatg
ttctcctttgaggagaccacttcctgcaaggcctgccagatgttactcagaggcacattc
taccagggatatcgctgttacaggtgccgggcacctgcacacaaggagtgtctggggaga
gtgcctccctgtggtcgccatgggcaagatttcgcaggaaccatgaagaaggacaagctc
catcgaagggcccaggacaagaaaaggaatgaattgggtctgcctaagatggaagtgttt
caggaatactatgggatccctcctccacctggagcctttgggccatttttacggctcaac
cctggggacattgtggagctcactaaggcagaggctgagcacaactggtgggagggaagg
aatactgctacaaatgaagtcggctggtttccctgtaacagagtgcatccctatgtccac
ggccctcctcaggacctgtctgtgcatctctggtatgcgggccctatggaacgagcaggc
gctgagggcatcctcaccaaccgttctgatgggacctatctggtgcggcagagggtgaaa
gatacagcggagttcgccatcagcattaagtataacgtggaggtcaagcatattaaaatc
atgacgtcagaggggttgtaccggatcacagagaagaaggctttccggggccttctggaa
ctggtagagttttatcagcagaattccctcaaagattgcttcaagtcgttggacaccacc
ttgcagtttccttataaggaacctgagaggagagccatcagcaagccaccagctggaagc
accaagtattttggcactgccaaagcccgctacgacttctgtgcccgggacaggtcggaa
ctgtcccttaaggagggtgatatcatcaagatcctcaataagaagggacagcaaggctgg
tggcgtggggagatctacggccggatcggctggttcccttctaactatgtggaggaagac
tattccgaatattgctga

DBGET integrated database retrieval system