KEGG   Mus musculus (house mouse): 22325
Entry
22325             CDS       T01002                                 
Symbol
Vav2, 2810040F13Rik, AI847175, Vav-2
Name
(RefSeq) vav 2 oncogene
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04510  Focal adhesion
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05135  Yersinia infection
mmu05205  Proteoglycans in cancer
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    22325 (Vav2)
   04024 cAMP signaling pathway
    22325 (Vav2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22325 (Vav2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    22325 (Vav2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    22325 (Vav2)
   04660 T cell receptor signaling pathway
    22325 (Vav2)
   04662 B cell receptor signaling pathway
    22325 (Vav2)
   04664 Fc epsilon RI signaling pathway
    22325 (Vav2)
   04666 Fc gamma R-mediated phagocytosis
    22325 (Vav2)
   04670 Leukocyte transendothelial migration
    22325 (Vav2)
   04062 Chemokine signaling pathway
    22325 (Vav2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    22325 (Vav2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    22325 (Vav2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    22325 (Vav2)
SSDB
Motif
Pfam: RhoGEF SH3_2 CAMSAP_CH CH SH3_1 SH3_9 SH2 C1_1 PH CDC24 SH2_2 PH_10 zf-RING_16 C1_2
Other DBs
NCBI-GeneID: 22325
NCBI-ProteinID: NP_033526
MGI: 102718
Ensembl: ENSMUSG00000009621
UniProt: Q60992 Q7TSI6
Position
2:complement(27152116..27317620)
AA seq 868 aa
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
AQSKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIKVEV
QQPMKMGMTEDDKRSCCLLEIQETEAKYYRTLEDIEKNYMGPLRLVLSPADMAAVFINLE
DLIKVHHSFLRAIDVSMMAGGSTLAKVFLEFKERLLIYGEYCSHMEHAQSTLNQLLASRE
DFRQKVEECTLRVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSADRPERQQLKEALEA
MQDLAMYINEVKRDKETLKKISEFQCSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDR
YLFLFDKVVIVCKRKGYSYELKEVIELLFHKMTDDPMHNKDIKKWSYGFYLIHLQGKQGF
QFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQ
GYLCTRCGVGAHKECLEVIPPCKMSSPADVDAPGAGPGPKMVAVQNYHGNPAPPGKPVLT
FQTGDVIELLRGDPDSPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPTGRPPSREIDYTA
YPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDSWIH
ITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKFPYKSRERTTSRASSRSPASCASYNF
SFLSPQGLSFAPQAPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREGDVVKIYSRIG
GDQGWWKGETNGRIGWFPSTYVEEEGVQ
NT seq 2607 nt   +upstreamnt  +downstreamnt
atggagcagtggcggcaatgcggccgctggctcatcgactgcaaggtcctgccgcccaac
caccgcgtcgtgtggccctcggcggtggtcttcgacctggcgcaggcgctgcgcgacggc
gtccttctgtgccagctgctgcacaacctctcccccggttccatcgaccttaaggacatc
aacttccggccgcagatgtcccagttcttgtgtctgaagaatattcgcaccttcctcaaa
gtctgccatgacaaatttggactaagaaacagtgagctgtttgaccctttcgacctcttt
gatgtccgagacttcgggaaggtcatctctgcagtgtcccgtctgtccctgcacagcatc
gcacagagcaaagggatcaggccatttccatcagaggagacagctgaaaatgatgacgac
gtctaccggagcctggaagagctggctgacgagcatgacctgggtgaggacatctacgac
tgtgtcccgtgtgaagatgaaggagatgacatttatgaggacatcatcaaggtggaggtg
cagcagcccatgaaaatgggcatgactgaggacgacaagagaagctgctgcttgttagag
attcaggagaccgaggccaagtactaccgcaccctggaggacattgagaagaactacatg
ggtcccttgcggctggtgctgagcccggcggatatggctgctgtcttcatcaacctggag
gacctcatcaaggtgcatcacagctttctgcgagccatcgatgtgtccatgatggctggt
ggcagtaccctggctaaggtctttctggagtttaaggaaaggctcctgatctatggagag
tactgtagccacatggaacacgctcagagtacactgaaccagctcctcgccagccgagag
gacttcaggcagaaagtggaggagtgcacactcagggttcaggatggcaagttcaagctg
caagacctgctggtggtgcccatgcaacgggtgctgaagtaccacctgctgctcaaggag
ctcctgagccattctgcagaccgaccagaaagacaacagctcaaagaagccctggaagcc
atgcaggacttggccatgtacatcaatgaagtgaagcgggacaaggagaccttgaagaag
attagcgagttccagtgctccatagaaaacctgcaagtgaagctggaggaatttgggagg
ccaaagattgacggggagcttaaagtccggtccatagtcaaccacaccaagcaagacagg
tacctgttcctatttgacaaggtggtcatcgtgtgcaagaggaagggctacagctatgag
ctgaaggaggtcattgagctgctcttccacaagatgaccgatgacccgatgcacaacaag
gacatcaagaagtggtcctatggcttctacctgattcacctccaaggaaagcaaggcttt
cagttcttctgcaagacggaagacatgaagcggaagtggatggagcagttcgagatggcc
atgtcaaacatcaagccagataaggccaatgccaaccatcatagcttccagatgtacaca
ttcgacaagactaccaactgcaaagcctgcaagatgtttctcaggggtaccttctaccag
ggatacctgtgtaccagatgtggcgtcggggcacacaaggaatgcctggaggtgatcccc
ccctgcaagatgagttcacctgcagatgtggatgctcctggagcaggaccaggtcccaag
atggttgctgtgcagaattaccatggtaacccagcccctcctgggaagcctgtgttgacc
ttccagacaggagacgtgatagaactgctccggggtgaccccgattctccttggtgggaa
gggcggctggttcaaaccaggaagtcagggtattttcccagctcatctgtgaagccctgc
ccagtggatggaaggccgcctactggccgcccaccatcccgggagatcgattacactgcc
tacccgtggtttgctggcaacatggaacggcagcagacggacaatctgctcaagtctcat
gccagtgggacctacctcatcagagagcgtccagcagaggcagaacgcttcgccatcagc
atcaagttcaatgatgaggtgaaacatatcaaggtggtggagaaagatagctggatccac
atcacggaagctaagaagtttgagagcctcctggagctggtggagtactaccagtgtcac
tcactcaaggaaagcttcaagcagttggacactacactcaagttcccctacaagtctcgg
gagcgaaccaccagcagggcctcaagccggtctccagcttcctgcgcttcctacaacttt
tcttttctcagtcctcagggcctcagctttgccccccaggccccttctgctcccttctgg
tcagtgttcacaccgcgggtcatcggcacagccgtggccaggtacaactttgctgctcga
gacatgcgggagctgtcactgcgagaaggtgatgtggtgaagatctacagccgaattggt
ggggaccagggctggtggaaaggagagacaaatgggcggatcggttggtttccttcgacg
tacgtggaagaggaaggcgtccagtga

DBGET integrated database retrieval system