KEGG   Mus musculus (mouse): 223272
Entry
223272            CDS       T01002                                 

Symbol
Itgbl1, B930011D01Rik
Name
(RefSeq) integrin, beta-like 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: EGF_2 I-EGF_1
Other DBs
NCBI-GeneID: 223272
NCBI-ProteinID: NP_663442
MGI: 2443439
Ensembl: ENSMUSG00000032925
Vega: OTTMUSG00000027793
UniProt: Q8VDV0
Position
14; 14 E5
AA seq 494 aa
MHPPGFRNFLLLVSSLLFIGLSAAPQSFLPSLRSLSGAPCRLSRAESERRCRAPGQPPGS
ALCHDRGRCECGVCICHVTEPGTYFGPLCECHEWICETYDGKTCAGHGNCDCGKCKCDVG
WSGEACQYPTKCDLTKKISNQMCKNSQDVICSNAGTCHCGRCKCDNSDGHGLIYGKFCEC
DDRECIDDETEEVCGGHGKCYCGNCYCEAGWHGDKCEFQCDITPWESKRRCTSPDGKVCS
NRGTCVCGECSCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCD
CRAGWYGKKCEHPRNCPLSAEESTKKCQGSSDLPCSGRGRCECGRCTCYPPGDSRVYGKT
CECDDRRCEDLDGVVCGGHGMCSCGRCVCEKGWFGKLCQHLRKCNMTEEQSRSLCESADG
TLCSGKGSCHCGKCICSGEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGW
NGNACEIWLGTEYP
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgcatcctccaggcttcaggaacttcttgttgctggtgtcctcccttctcttcattggg
ctgtcagctgctcctcaaagcttcttaccatctctgagaagcctgtcgggcgccccctgc
aggctgtcccgggcagagtccgaacgcagatgtcgtgcacctgggcagcccccagggagc
gctctgtgccatgaccgtggccggtgcgagtgtggggtctgcatctgtcacgtgaccgaa
cctggcacctacttcggtccactgtgtgagtgccatgagtggatatgcgagacctacgac
gggaaaacctgtgcaggccacggtaattgtgactgcggcaagtgcaagtgtgatgtggga
tggtctggggaagcttgtcagtacccaaccaagtgtgacctgaccaaaaaaatcagcaac
cagatgtgcaagaactcccaagatgtcatctgctccaatgcaggtacatgtcactgtggc
aggtgtaagtgtgataattcagatggacatggactcatttatggtaaattttgtgaatgt
gatgatagagaatgcatagatgatgaaacagaagaagtatgtggaggccatgggaagtgt
tactgtggaaactgttactgtgaggctggttggcatggcgataaatgcgagttccagtgt
gacatcaccccatgggaaagcaagcgaagatgcacatctccagatggcaaagtctgtagc
aacagaggaacatgtgtatgtggtgaatgttcttgccatgatgttgatccaactggggac
tggggagacattcatggggacacgtgtgagtgtgatgaaagggactgcagagctgtttat
gatcgatactctgatgatttctgttcaggtcatgggcagtgtaactgtggaagatgtgac
tgcagagcaggctggtatgggaagaaatgtgagcacccaaggaattgcccattgtcagct
gaggagagcaccaagaagtgccagggtagttctgatcttccttgctctggaaggggcaga
tgcgaatgtggcagatgcacttgttaccctcctggggacagcagagtctatggcaagacc
tgtgagtgtgatgaccggcgctgcgaggacctggatggtgtggtctgcggaggccatggc
atgtgctcctgtggtcgctgtgtttgtgagaaaggatggtttggtaagctctgccaacac
ctgcggaagtgtaatatgacagaagaacaaagcaggagtctgtgtgagtcagcagatggc
acattgtgctcagggaagggttcttgtcattgtggaaagtgcatttgttctggagaagag
tggtatatttcaggggagttttgtgactgtgatgacagagactgtgacaaacacgatggt
ctcatttgcacagggaatggaatctgtagctgtggaaactgtgaatgctgggatggatgg
aatggaaatgcatgtgaaatctggcttggtaccgaatatccttaa

DBGET integrated database retrieval system