KEGG   Mus musculus (mouse): 22330Help
Entry
22330             CDS       T01002                                 

Gene name
Vcl, 9430097D22, AA571387, AI462105, AW545629
Definition
(RefSeq) vinculin
  KO
K05700  vinculin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05100  Bacterial invasion of epithelial cells
mmu05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22330 (Vcl)
   04520 Adherens junction
    22330 (Vcl)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    22330 (Vcl)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    22330 (Vcl)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    22330 (Vcl)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    22330 (Vcl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    22330 (Vcl)
   04147 Exosome [BR:mmu04147]
    22330 (Vcl)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     22330 (Vcl)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   22330 (Vcl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vinculin
Motif
Other DBs
NCBI-GeneID: 22330
NCBI-ProteinID: NP_033528
MGI: 98927
Ensembl: ENSMUSG00000021823
UniProt: Q64727
Structure
PDB: 

Position
14 A3; 14 11.53 cM
AA seq 1066 aa AA seqDB search
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKE
TVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTS
DLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQ
ELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAE
INEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPNASPGDAGEQAIR
QILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGASPVAMQKAQQVSQGL
DVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAE
LCDDPKERDDILRSLGEIAALTSKLGDLRRQGKGDSPEARALAKQVATALQNLQTKTNRA
VANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQD
LLAKCDRVDQLTAQLADLAARGEGESPQARALASQLQDSLKDLKAQMQEAMTQEVSDVFS
DTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGRLGATAEKAAAVGTANKSTVEG
IQASVKTARELTPQVISAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTK
SLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKFR
EAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEP
DFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM
AARQLHDEARKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKASDE
VTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQAT
EMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgtttcacacgcgtacgatcgagagcatcctggagccggtggcgcagcagatc
tcgcacctggtgattatgcacgaggagggcgaggtggacggcaaagccattcctgacctc
accgcgcccgtagccgccgtgcaggcggccgtcagcaacctcgtccgggttggaaaagag
actgttcagaccactgaggatcagattctgaagagagatatgccaccagcctttattaag
gttgaaaatgcttgcaccaagcttgttcaggcagcccagatgcttcagtcagacccatac
tcggttcctgcgcgggattacctcattgacggctctaggggaatcctttctggcacatct
gacctactgcttaccttcgatgaggctgaggttcgtaaaattattagggtttgcaaagga
attttggaatatcttacagtggcagaggtagtggaaactatggaagacttggtcacttac
acaaagaatcttgggccaggaatgactaagatggccaaaatgattgatgagagacagcag
gagttgactcaccaggaacaccgtgtgatgttggtgaactcaatgaacactgtcaaagag
ctgcttcctgttctcatttcagctatgaagatttttgttacaaccaaaaactcaaaaaac
caaggaatagaagaagctttgaaaaatcgaaattttactgtagaaaagatgagtgctgaa
attaacgagatcattcgtgtgttacaactcacttcctgggatgaagatgcctgggccagc
aaggacactgaagccatgaagagagcgctggcgtccatagactccaaattgaaccaggcc
aaaggttggctccgtgaccccaatgcctccccaggggatgctggagagcaggccatcagg
cagatcttagatgaagctggaaaagttggtgaactttgtgcaggcaaggaacgcagggag
atcctaggaacctgcaaaatgctagggcagatgactgaccaagtggctgacctccgagcc
agaggacaaggagcttccccagtggccatgcagaaggcccagcaagtgtctcaggggctc
gacgtgcttaccgccaaagtggagaatgcagctcggaagctggaagccatgacgaactca
aagcagagcattgcaaagaagattgatgctgcccagaattggctggcggatccaaatggt
ggacctgagggagaagaacagattcgaggggctttggctgaagctcggaagattgcagaa
ttatgtgatgatcctaaggagagagatgacatcctccgctcccttggagagatagctgct
ctgacctctaaactaggagacttgcgaagacaggggaaaggagactcgccagaggctcga
gccttggctaaacaagtggcgacggcactacagaacctgcagaccaaaaccaacagggcc
gtggccaacagcagacctgccaaagcagctgtccacctcgagggcaagattgaacaggcg
cagcggtggattgataaccccacagtagatgaccgtggagtcggtcaggctgccatccgt
ggacttgtggctgaggggcatcggctggccaatgtcatgatgggaccttatcgccaagat
cttcttgccaaatgtgaccgtgtagaccagctaacagctcagctggctgacctggctgcc
cgaggggagggggagagtcctcaggcgagagcacttgcatcccagcttcaggactcctta
aaggatcttaaagcccagatgcaggaagctatgactcaagaggtatccgatgttttcagc
gatactacaactcctatcaagctgttggcagtagccgccactgctcctcctgatgcaccc
aatagggaagaggtatttgatgaaagggcagccaattttgaaaaccattcaggaaggctt
ggagccacagcagagaaggcggctgctgttggtactgccaataaatcgacagtggaaggc
attcaggcatctgtgaagacagcccgagaactcactccccaggtcatctccgctgctcgg
atcttactgaggaaccctggtaaccaggctgcttatgaacattttgagaccatgaagaac
cagtggattgataatgttgaaaaaatgacagggctggtggacgaggctattgataccaag
tctctgttggatgcttctgaagaagcaattaaaaaagacctggacaagtgtaaggtagcc
atggccaatattcagcctcagatgctggtcgctggagcaaccagtattgctcgtcgggcc
aaccggattctgctggttgctaagagggaggtagagaactctgaggacccgaagttccga
gaggctgtgaaagctgcctctgatgaactgagcaaaacaatctcccccatggtgatggat
gccaaggctgtggctggaaacatctctgaccctggcctgcaaaagagcttcctggactca
ggatatcggatcctgggagctgtggccaaggtcagagaagccttccaacctcaggagcct
gacttcccgcctcctccaccagaccttgaacagctacgactaactgatgagctggctcct
cctaagccacctctgcctgagggtgaagtccctccacccaggcccccaccaccagaagag
aaggatgaagagttccctgagcagaaagctggtgaggtgattaaccagccaatgatgatg
gccgccaggcagctccacgatgaagctcggaaatggtctagcaagggcaatgacatcatt
gcagcagccaagcgcatggctctgctgatggcagagatgtctcggctggtaagagggggc
agtggtaccaagcgggcacttattcagtgtgccaaggatatcgccaaggcctctgatgag
gtgacgaggttggccaaggaggttgccaagcagtgcacagataagcggattagaaccaat
ctcttacaggtatgcgagcgaatcccaactataagcacccagctcaaaatcctatccaca
gtgaaggccactatgctgggccggaccaacatcagtgatgaggagtctgagcaggccaca
gagatgctggttcataatgcccagaacctcatgcagtctgtgaaggagactgtgcgagag
gctgaagctgcttcaatcaaaatccgaacagatgctggctttactctgcgctgggtcaga
aagactccctggtaccagtag

DBGET integrated database retrieval system