KEGG   Mus musculus (mouse): 22333
Entry
22333             CDS       T01002                                 

Gene name
Vdac1, AL033343, Vdac5, mVDAC1, mVDAC5
Definition
(RefSeq) voltage-dependent anion channel 1
  KO
K05862  voltage-dependent anion channel protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04217  Necroptosis
mmu04218  Cellular senescence
mmu04621  NOD-like receptor signaling pathway
mmu04979  Cholesterol metabolism
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    22333 (Vdac1)
   04022 cGMP-PKG signaling pathway
    22333 (Vdac1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    22333 (Vdac1)
   04218 Cellular senescence
    22333 (Vdac1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    22333 (Vdac1)
  09154 Digestive system
   04979 Cholesterol metabolism
    22333 (Vdac1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    22333 (Vdac1)
   05012 Parkinson disease
    22333 (Vdac1)
   05014 Amyotrophic lateral sclerosis
    22333 (Vdac1)
   05016 Huntington disease
    22333 (Vdac1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    22333 (Vdac1)
   05164 Influenza A
    22333 (Vdac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    22333 (Vdac1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    22333 (Vdac1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    22333 (Vdac1)
Ion channels [BR:mmu04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   22333 (Vdac1)
SSDB
Motif
Pfam: Porin_3
Other DBs
NCBI-GeneID: 22333
NCBI-ProteinID: NP_035824
MGI: 106919
Ensembl: ENSMUSG00000020402
Vega: OTTMUSG00000005626
UniProt: Q60932
Structure
PDB: 
4C69 3EMN

Position
11 B1.3; 11 31.86 cM
AA seq 283 aa
MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVNGSLET
KYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKR
EHINLGCDVDFDIAGPSIRGALVLGYEGWLAGYQMNFETSKSRVTQSNFAVGYKTDEFQL
HTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQVDPDACFSAKVNNS
SLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
NT seq 852 nt   +upstreamnt  +downstreamnt
atggccgtgcctcccacatacgccgatcttggcaagtccgccagggatgtcttcaccaag
ggctacggctttggcttaataaaacttgatttgaaaacgaagtcagagaatggattggaa
tttaccagctcaggctctgccaacacggaaaccaccaaagtgaacggcagcctggaaacc
aagtacagatggactgagtatgggctgacgtttacagagaagtggaacacagacaacacc
ctgggcactgagatcactgtggaagaccagcttgctcgtggactgaagctcacctttgat
tcgtcattctcgccgaacactgggaaaaaaaatgctaaaatcaagacagggtacaagagg
gagcacatcaacctcggctgtgacgtggactttgacatcgctgggccctcgatccggggc
gctctggtgcttggctatgagggttggctggctggctaccagatgaattttgagacctcg
aagtcccgagtgacccagagcaacttcgcagttggctataagacggatgaattccagctt
catactaatgtgaatgacgggacagagtttggtggctccatttaccagaaggtgaacaag
aagttggagactgctgtcaatctcgcctggactgcaggaaacagtaacactcgcttcgga
atagcagccaagtatcaggtcgaccctgatgcctgcttttcggccaaagtgaacaactct
agcctgattggcttagggtacactcagaccctaaaaccaggtatcaaactgacgttgtca
gccctgctcgatggcaagaacgtcaatgcgggtggccacaagcttggcctaggactggaa
tttcaagcataa

DBGET integrated database retrieval system