KEGG   Mus musculus (mouse): 22335Help
Entry
22335             CDS       T01002                                 

Gene name
Vdac3
Definition
(RefSeq) voltage-dependent anion channel 3
  KO
K15041  voltage-dependent anion channel protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04216  Ferroptosis
mmu04217  Necroptosis
mmu04218  Cellular senescence
mmu04621  NOD-like receptor signaling pathway
mmu04979  Cholesterol metabolism
mmu05012  Parkinson's disease
mmu05016  Huntington's disease
mmu05161  Hepatitis B
mmu05166  HTLV-I infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    22335 (Vdac3)
   04022 cGMP - PKG signaling pathway
    22335 (Vdac3)
 Cellular Processes
  Cell growth and death
   04216 Ferroptosis
    22335 (Vdac3)
   04217 Necroptosis
    22335 (Vdac3)
   04218 Cellular senescence
    22335 (Vdac3)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    22335 (Vdac3)
  Digestive system
   04979 Cholesterol metabolism
    22335 (Vdac3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    22335 (Vdac3)
  Neurodegenerative diseases
   05012 Parkinson's disease
    22335 (Vdac3)
   05016 Huntington's disease
    22335 (Vdac3)
  Infectious diseases
   05166 HTLV-I infection
    22335 (Vdac3)
   05161 Hepatitis B
    22335 (Vdac3)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    22335 (Vdac3)
Ion channels [BR:mmu04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   22335 (Vdac3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Porin_3
Motif
Other DBs
NCBI-GeneID: 22335
NCBI-ProteinID: NP_035826
MGI: 106922
Ensembl: ENSMUSG00000008892
Vega: OTTMUSG00000060891
UniProt: Q60931 Q3TX38
Position
8 A2; 8 11.42 cM
AA seq 283 aa AA seqDB search
MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLET
KYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYRR
DCFSLGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQL
HTHVNDGTEFGGSIYQKVNERIETSINLAWTAGSNNTRFGIAAKYKLDCRTSLSAKVNNA
SLIGLGYTQTLRPGVKLTLSALIDGKNFNAGGHKVGLGFELEA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaacacaccaacttattgcgacctaggaaaggctgccaaggatgtctttaacaaa
gggtatgggtttggcatggtcaagatagatctgaaaaccaagtcttgtagtggagtggaa
ttttctacttcaggtcatgcttatactgatacagggaaagcatcaggcaacctagagacc
aaatataaggtctgcaactatgggctcaccttcacccaaaagtggaatacagacaatact
cttgggacagaaatctcttgggagaataagttggctgaagggttgaaactgactcttgat
accatatttgtaccaaacacaggaaagaagagtgggaaattaaaggcctcctatagacgg
gattgttttagtctcggcagtaatgttgatatagatttttctggaccgaccatctatggc
tgggctgtgttggcctttgaaggttggcttgctggctatcagatgagttttgacacagcc
aaatccaaactgtctcagaataatttcgctcttggttacaaggctgcagacttccagctg
catactcacgtgaatgatggcactgagtttggaggctcaatctaccagaaagttaacgag
aggattgaaacgtcaataaacctggcatggacagctggcagcaacaacactcgttttggc
atcgctgctaaatataagctggattgtagaacttctctatctgccaaagtaaacaatgcc
agtttaattggactgggttatacgcagaccctccgaccaggagtcaaactgaccctgtca
gctttaatagatggaaagaacttcaatgcaggaggccacaaggttggattgggatttgaa
ctggaggcttag

DBGET integrated database retrieval system