KEGG   Mus musculus (mouse): 22335
Entry
22335             CDS       T01002                                 

Symbol
Vdac3
Name
(RefSeq) voltage-dependent anion channel 3
  KO
K15041  voltage-dependent anion channel protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04216  Ferroptosis
mmu04217  Necroptosis
mmu04218  Cellular senescence
mmu04613  Neutrophil extracellular trap formation
mmu04621  NOD-like receptor signaling pathway
mmu04979  Cholesterol metabolism
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05161  Hepatitis B
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    22335 (Vdac3)
   04022 cGMP-PKG signaling pathway
    22335 (Vdac3)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    22335 (Vdac3)
   04217 Necroptosis
    22335 (Vdac3)
   04218 Cellular senescence
    22335 (Vdac3)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    22335 (Vdac3)
   04621 NOD-like receptor signaling pathway
    22335 (Vdac3)
  09154 Digestive system
   04979 Cholesterol metabolism
    22335 (Vdac3)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    22335 (Vdac3)
   05203 Viral carcinogenesis
    22335 (Vdac3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    22335 (Vdac3)
   05161 Hepatitis B
    22335 (Vdac3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    22335 (Vdac3)
   05012 Parkinson disease
    22335 (Vdac3)
   05016 Huntington disease
    22335 (Vdac3)
   05017 Spinocerebellar ataxia
    22335 (Vdac3)
   05020 Prion disease
    22335 (Vdac3)
   05022 Pathways of neurodegeneration - multiple diseases
    22335 (Vdac3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    22335 (Vdac3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    22335 (Vdac3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    22335 (Vdac3)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    22335 (Vdac3)
Ion channels [BR:mmu04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   22335 (Vdac3)
SSDB
Motif
Pfam: Porin_3
Other DBs
NCBI-GeneID: 22335
NCBI-ProteinID: NP_035826
MGI: 106922
Ensembl: ENSMUSG00000008892
Vega: OTTMUSG00000060891
UniProt: Q60931 Q3TX38
Position
8 A2; 8 11.42 cM
AA seq 283 aa
MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLET
KYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYRR
DCFSLGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQL
HTHVNDGTEFGGSIYQKVNERIETSINLAWTAGSNNTRFGIAAKYKLDCRTSLSAKVNNA
SLIGLGYTQTLRPGVKLTLSALIDGKNFNAGGHKVGLGFELEA
NT seq 852 nt   +upstreamnt  +downstreamnt
atgtgtaacacaccaacttattgcgacctaggaaaggctgccaaggatgtctttaacaaa
gggtatgggtttggcatggtcaagatagatctgaaaaccaagtcttgtagtggagtggaa
ttttctacttcaggtcatgcttatactgatacagggaaagcatcaggcaacctagagacc
aaatataaggtctgcaactatgggctcaccttcacccaaaagtggaatacagacaatact
cttgggacagaaatctcttgggagaataagttggctgaagggttgaaactgactcttgat
accatatttgtaccaaacacaggaaagaagagtgggaaattaaaggcctcctatagacgg
gattgttttagtctcggcagtaatgttgatatagatttttctggaccgaccatctatggc
tgggctgtgttggcctttgaaggttggcttgctggctatcagatgagttttgacacagcc
aaatccaaactgtctcagaataatttcgctcttggttacaaggctgcagacttccagctg
catactcacgtgaatgatggcactgagtttggaggctcaatctaccagaaagttaacgag
aggattgaaacgtcaataaacctggcatggacagctggcagcaacaacactcgttttggc
atcgctgctaaatataagctggattgtagaacttctctatctgccaaagtaaacaatgcc
agtttaattggactgggttatacgcagaccctccgaccaggagtcaaactgaccctgtca
gctttaatagatggaaagaacttcaatgcaggaggccacaaggttggattgggatttgaa
ctggaggcttag

DBGET integrated database retrieval system