KEGG   Mus musculus (mouse): 223455
Entry
223455            CDS       T01002                                 

Gene name
Marchf6, 3830408G03, F830029L24Rik, Marc, March6, mKIAA0597
Definition
(RefSeq) membrane associated ring-CH-type finger 6
  KO
K10661  E3 ubiquitin-protein ligase MARCH6 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    223455 (Marchf6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    223455 (Marchf6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     223455 (Marchf6)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   March proteins
    223455 (Marchf6)
SSDB
Motif
Pfam: RINGv zf-ANAPC11 zf-RING_2
Other DBs
NCBI-GeneID: 223455
NCBI-ProteinID: NP_766194
MGI: 2442773
Ensembl: ENSMUSG00000039100
UniProt: Q6ZQ89
Position
15; 15 B2
AA seq 909 aa
MDTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFA
FTPIYSPDMPSRLPIQDIFAGLVTSIGTAIRYWFHYTLVAFAWLGVVPLTACRIYKCLFT
GSVSSLLTLPLDMLSTENLLADCLQGCFVVTCTLCAFISLVWLREQIVHGGAPIWLEHAA
PPFNAAGHHQNEAPVGGNGAENPAADQPANPAGENAVLGENPDAQDGQAEEEEEDNEEED
DAGVEDAADANNGAQDDMNWNALEWDRAAEELTWERMLGLDGSLVFLEHVFWVVSLNTLF
ILVFAFCPYHIGHFSLVGLGFEEHVQASHFEGLITTIVGYILLAITLIICHALATLVKFH
RSRRLLGVCYIVVKVSLLVVVEIGVFPLICGWWLDICSLEMFDATLKDRELSFQSAPGTT
MFLHWLVGMVYVFYFASFILLLREVLRPGVLWFLRNLNDPDFNPVQEMIHLPIYRHLRRF
ILSVIVFGSIVLLMLWLPIRIIKSLLPNFLPYNVMLYSDAPVSELSLELLLLQVVLPALL
EQGHTRQWLKGLVRAWTVTAGYLLDLHSYLLGDQEENENSANQQVNNNQPARNNNAVPAG
EGLHAAHQAILQQGGPVGFQPYRRPLNFPLRIFLLIVFMCITLLIASLICLTLPVFAGRW
LMSFWTGTAKIHELYTAACGLYVCWLTIRAVTVLVAWMPQGRRVIFQKVKEWSLMIMKTL
IVAVLLAGVVPLLLGLLFELVIVAPLRVPLDQTPLFYPWQDWALGVLHAKIIAAITLMGP
QWWLKTVIEQVYANGIRNIDLHYIIRKLAAPVISVLLLSLCVPYVIASGAVPLLGVTAEM
QNLVHRRIYPFLLMVVVLMGILSFQVRQFKRLYEHIKNDKYLVGQRLVNYERKSGKQGPS
TPPPVSSQE
NT seq 2730 nt   +upstreamnt  +downstreamnt
atggacaccgccgaggaagatatatgtagagtgtgtcggtcagaaggaacacctgagaaa
cctctttatcatccttgtgtatgtactggcagtattaaatttattcatcaagaatgctta
gttcagtggttgaaacatagtcggaaagaatactgtgaattatgcaagcacagatttgct
ttcacaccaatttattctccagatatgccttcacggctaccaatccaagacatatttgct
ggactggttacaagtattggcactgcaatacgatactggtttcattacacacttgtggcc
tttgcatggctgggagttgttcctcttacagcatgccgcatctacaagtgcttgtttact
ggctccgtgagctcactactgacactgccactagacatgctgtcaacggaaaatttgttg
gcggattgcttgcagggctgttttgtggtgacgtgcacactttgtgcgttcatcagcctg
gtgtggttacgagagcagatagtccacgggggagccccaatttggctggagcatgctgct
ccacccttcaatgctgctggacaccaccaaaatgaggctcctgtaggaggaaatggtgca
gaaaaccctgctgctgatcagccagctaacccagcaggtgagaatgcagttctgggtgaa
aaccctgatgcccaggacggtcaagcagaagaggaagaggaggacaatgaggaggaagat
gatgcgggtgtagaagatgctgctgatgccaacaatggagcccaagacgacatgaactgg
aatgctttagagtgggaccgggctgcagaagagcttacttgggaaagaatgcttggactt
gatggatcactagttttcctggaacacgtgttctgggtggtgtctttaaatacattgttc
attcttgtttttgcattttgtccttaccacatcggccatttctcccttgttggcttgggg
tttgaggagcatgtccaagcatctcattttgaaggtctaatcacaacgattgttggatat
atacttttagcaataacactgataatttgtcatgcattggcaactcttgttaaatttcat
aggtctcgtcgcttgctgggcgtctgctatattgtggttaaggtctctttgttagttgtg
gtagaaatcggagtgttccctctcatttgtggctggtggctggatatctgttctctggaa
atgtttgatgctactctgaaagatcgagagctgagctttcagtcagctccagggaccacg
atgtttctgcactggttggtgggaatggtgtatgtgttctactttgcctccttcatcctg
ttactgagagaggtacttcgacctggtgtcttatggtttctgaggaatttgaacgatcca
gattttaatccagtacaggaaatgattcacttgcccatttatagacatctccgaagattt
attttgtcagtgattgtctttggctccattgtccttctgatgctctggcttcctatacgt
ataattaagagtctcttgcctaattttcttccttacaatgtcatgctctacagtgatgct
ccggtgagtgagctgtcccttgagctgctcctactgcaggttgtcttgccagcattgctg
gaacagggacacacgaggcagtggctgaaggggcttgtgcgtgcatggactgttactgct
ggatacttgctggaccttcattcctacttactgggagatcaggaagaaaacgagaacagt
gcaaatcagcaggtcaacaataaccagcctgcacgaaacaataatgctgttcctgccggg
gaaggtctgcatgcagcccaccaagccatactccagcagggaggacctgttggctttcag
ccttaccgccggcctttaaatttcccactcaggatatttctgctgattgtcttcatgtgc
ataacattgctaattgccagcctcatttgccttactttaccagtatttgctggccgttgg
ttaatgtcattttggacggggactgccaaaatccatgagctgtacacagctgcttgtggt
ctctatgtgtgttggctaaccataagggctgtgacggtgctggtggcctggatgccccag
ggacgaagagtgattttccagaaggttaaagagtggtccctcatgataatgaagacgttg
atagttgctgtgctgctggctggggtcgtcccactgctcctcgggctcctgtttgagctg
gttattgttgctcctctgagggtccctcttgatcagactccccttttctacccttggcag
gactgggcgctgggagtgctgcatgccaaaattatcgcagctataactcttatgggtcct
cagtggtggttgaaaactgtcattgaacaggtttacgcaaatggcattcgtaacatcgac
cttcactatatcatccgtaagctggcagccccggtgatctctgtgctcttactttccctg
tgtgtaccgtatgtcatagcttctggcgcggttcctctactaggtgttactgcagagatg
cagaacttagttcaccggcggatttacccatttttattgatggtcgttgtgctgatggga
atcctgtccttccaggtccgccagtttaagcgcctttatgaacacattaaaaatgacaag
taccttgtggggcagcgcctggtgaactatgagcgcaaatccggcaagcaaggcccgtct
acaccgcctccggtgtcgtcccaagaataa

DBGET integrated database retrieval system