KEGG   Mus musculus (house mouse): 22348
Entry
22348             CDS       T01002                                 
Symbol
Slc32a1, R75019, VGAT, Viaat
Name
(RefSeq) solute carrier family 32 (GABA vesicular transporter), member 1
  KO
K15015  solute carrier family 32 (vesicular inhibitory amino acid transporter)
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04723  Retrograde endocannabinoid signaling
mmu04727  GABAergic synapse
mmu05032  Morphine addiction
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    22348 (Slc32a1)
   04723 Retrograde endocannabinoid signaling
    22348 (Slc32a1)
   04721 Synaptic vesicle cycle
    22348 (Slc32a1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    22348 (Slc32a1)
   05033 Nicotine addiction
    22348 (Slc32a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    22348 (Slc32a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC32: Vesicular inhibitory amino acid transporter
   22348 (Slc32a1)
SSDB
Motif
Pfam: Aa_trans
Other DBs
NCBI-GeneID: 22348
NCBI-ProteinID: NP_033534
MGI: 1194488
Ensembl: ENSMUSG00000037771
UniProt: O35633 Q49S98
Position
2:158449180..158457667
AA seq 525 aa
MATLLRSKLTNVATSVSNKSQAKVSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQM
DILKSEGEPCGDEGAEAPVEGDIHYQRGGAPLPPSGSKDQAVGAGGEFGGHDKPKITAWE
AGWNVTNAIQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEVV
RVRDSYVAIANACCAPRFPTLGGRVVNVAQIIELVMTCILYVVVSGNLMYNSFPGLPVSQ
KSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWEKVKFY
IDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFALVAYL
TWADETKEVITDNLPGSIRAVVNLFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFPA
CYGGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLRL
LWRKLLWHQVFFDVAIFVIGGICSVSGFVHSLEGLIEAYRTNAED
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggccaccctgctccgcagcaagctgaccaatgtggccacctccgtgtccaacaagtcc
caggccaaggtgagcggcatgtttgccaggatggggtttcaggcggccaccgatgaggaa
gcggtgggcttcgcgcactgcgacgatctcgactttgagcatcgccagggcctgcagatg
gacatcctgaaatcggaaggcgagccctgcggagacgagggcgcagaagctcccgtcgag
ggagacattcattatcagcgcggcggcgctcctctgccaccctctggctccaaggaccag
gccgtgggagctggtggggagttcgggggtcacgacaaacccaagatcacggcgtgggaa
gcgggctggaacgtgacaaatgccattcagggcatgttcgtgctgggcctaccctacgcc
atcctccacggcggctacctggggttgttcctcatcatcttcgccgcagtggtgtgctgc
tacaccggcaagatcctcatcgcgtgcctgtacgaggagaacgaagacggggaggtggtg
cgcgtgcgggactcgtatgtggccatagctaacgcatgctgcgctcctcgattccccacc
ctgggcggccgcgtggtcaatgtggcgcagatcatcgagctggtgatgacgtgtatcttg
tacgtcgtggtgagcggcaacctcatgtacaacagtttcccggggctgcccgtgtcgcag
aagtcctggtccatcatagccacagcggtgctgctgccctgcgccttcctgaagaatctc
aaggccgtgtccaagttcagtctgctgtgtacgctggcccacttcgtcatcaacatcctg
gtcatcgcttactgtctctctcgcgcgcgtgattgggcctgggagaaggtgaagttctac
atcgacgtcaagaagtttcccatctccattggcatcatcgtgttcagctacacgtcgcag
atcttcctgccctctctcgaaggcaacatgcagcagcccagcgaattccactgcatgatg
aactggacacacatcgccgcctgcgtgctcaagggtctcttcgcgctcgtcgcctacctc
acctgggccgacgagaccaaggaagtcatcacggataacctgcccggctccatccgcgcc
gtggtcaacctcttcctggtggccaaggcgctgctgtcctatccgttgcccttcttcgcg
gccgtcgaagtgctggagaagtctctcttccaggaaggcagtcgcgccttcttccccgcc
tgctatggaggcgacggtcgccttaagtcctgggggctgacgctgcgctgcgcgctggtg
gtcttcacgctgctcatggccatctacgtgccacacttcgcgctgctcatgggcctcacg
ggcagcctcacaggcgccggcctctgcttcctgctgcccagcctcttccacttgcgcctt
ctctggcgcaagctgctgtggcaccaggtcttcttcgatgtggccatcttcgtcatcggc
ggcatctgcagcgtgtccggcttcgtgcattcactcgagggtctcatcgaggcctaccga
accaacgcagaggactag

DBGET integrated database retrieval system