KEGG   Mus musculus (mouse): 223527Help
Entry
223527            CDS       T01002                                 

Gene name
Eny2, 1810057B09Rik, 6720481I12, DC6, Ey2
Definition
(RefSeq) ENY2 transcription and export complex 2 subunit
  KO
K11368  enhancer of yellow 2 transcription factor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    223527 (Eny2)
   03019 Messenger RNA biogenesis [BR:mmu03019]
    223527 (Eny2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    223527 (Eny2)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     223527 (Eny2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     223527 (Eny2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    SAGA complex
     223527 (Eny2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EnY2 DUF2294
Motif
Other DBs
NCBI-GeneID: 223527
NCBI-ProteinID: NP_778174
MGI: 1919286
Ensembl: ENSMUSG00000022338
UniProt: Q9JIX0
Position
15; 15 B3.2
AA seq 101 aa AA seqDB search
MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLE
HVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggtggttagcaagatgaacaaagatgcgcagatgagagcagcgattaaccaaaagtta
atagaaactggagaaagagaacgcctcaaagagttgctgagagctaaattaattgagtgc
ggctggaaggatcagctaaaggcacactgtaaagaggtaattaaagaaaaaggactagaa
cacgttactgttgatgacttggtggctgaaatcactccaaaaggcagagccctggtacct
gacagtgtaaagaaggagctcctacagagaataagaacattccttgctcagcatgccagc
ctttaa

DBGET integrated database retrieval system