KEGG   Mus musculus (mouse): 22354
Entry
22354             CDS       T01002                                 

Gene name
Vipr1, AV071699, VIP-R1, VPAC1
Definition
(RefSeq) vasoactive intestinal peptide receptor 1
  KO
K04589  vasoactive intestinal peptide receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    22354 (Vipr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    22354 (Vipr1)
G protein-coupled receptors [BR:mmu04030]
 Secretin receptor family
  Gut peptide
   Vasoactive intestinal polypeptide (VIP) and pituitary adenyl cyclase-activating peptide (PACAP)
    22354 (Vipr1)
SSDB
Motif
Pfam: 7tm_2 HRM
Other DBs
NCBI-GeneID: 22354
NCBI-ProteinID: NP_035833
MGI: 109272
Ensembl: ENSMUSG00000032528
Vega: OTTMUSG00000027442
UniProt: P97751
Position
9 F4; 9 72.5 cM
AA seq 459 aa
MRPPSLPPARWLCVLAGALACALGPAGSRAASPHQECEYLQMIEKQRQQCLEEAQLENET
TGCSKMWDNLTCWPTTPWGQVVVLDCPLIFQLFSPIHGYNISRNCTEEGWSQLEPGPYHI
ACGLNDRASSMDEQQQTEFYDAVKTGYTIGYSLSLASLLVAMAILSLFRKLHCTRNYIHM
HLFMSFILRATAVFIKDMALFNNGETDHCSEASVSCKAAVVFFQYCVMANFFWLLVEGLY
LHTLLAVSFFSERKYFWGYILIGWGVPSVFIMIWTIVRIHFEDFGCWDTIINSSLWWIIK
GPILISILVNFILFICIIRILVQKLRPPDIGKNDSSPYSRLAKSTLLLIPLFGVHYVMFA
FFPDNFKAQVKMVFELVVGSFQGFVVAILYCFLNGEVQAELRRKWRRWHLQGVLGWSSKS
QHPWGGSNGVSCSTQVSMLTRVSPSARRSSSFQAEVSLV
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgcgccctccgagcctaccgcctgcccgctggctctgcgtgctggcaggagccctcgcc
tgcgccctcggacccgcgggcagccgggcagccagcccacaccaggagtgtgagtacctg
cagatgattgagaaacagcgtcagcagtgcctggaggaggcccagctggagaatgaaacc
acaggctgcagcaagatgtgggacaacctcacctgctggccaacgaccccttggggccag
gtggtagtcctggactgccccctcatctttcaactgttttcccccattcacggctataac
atcagccgtaactgcactgaagaaggctggtcacaactggaacctggcccctaccacatt
gcctgcggcctgaatgacagggcatctagtatggatgagcagcaacagactgagttctac
gatgcagtgaagaccggctacaccatcggctacagcttgtcccttgccagcctcctggtt
gccatggctatcttgagcctgttcaggaagctgcactgtactcgaaactacatccacatg
catctcttcatgtccttcatcctgagggccaccgccgtcttcatcaaggatatggccctc
ttcaacaacggggagacagaccactgctctgaggcctcggtgagctgcaaggcagcagtg
gttttcttccagtattgcgtcatggccaacttcttctggctgctggtcgagggcctctac
ctacacaccctgctggccgtctccttcttctctgagcggaagtacttctgggggtacata
ctcatcggctggggagtgcccagtgtgttcatcatgatatggacgattgtcaggatccat
tttgaggatttcgggtgctgggacaccatcatcaactcctcactgtggtggatcataaag
ggccccatcctcatctccatcttggtgaacttcatcctgtttatctgcatcatccgaatc
ctggttcagaagctacggccacccgacattgggaagaatgatagcagcccatactcgagg
ctggccaagtccacacttctgctcatccctctgtttggagttcactatgtcatgtttgcc
ttcttccccgacaactttaaggcccaggtgaaaatggtctttgaactcgtcgtagggtct
ttccagggttttgtggtggccatcctctactgcttcctcaatggcgaggtgcaggcagag
ctgcgacggaagtggcggcgttggcatctgcagggcgtcctgggctggagctccaaatca
caacacccgtggggaggcagcaacggcgtctcgtgcagcacacaggtgtccatgctgacc
cgcgtcagcccgagcgcgcgccgctcctccagcttccaagcggaggtctccctggtctga

DBGET integrated database retrieval system