KEGG   Mus musculus (mouse): 223593
Entry
223593            CDS       T01002                                 

Symbol
Washc5, AL022848, C76463, E430025E21Rik, strumpellin
Name
(RefSeq) WASH complex subunit 5
  KO
K18464  WASH complex subunit strumpellin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    223593 (Washc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    223593 (Washc5)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Others
   WASH complex
    223593 (Washc5)
SSDB
Motif
Pfam: Strumpellin DUF6563 IMD
Other DBs
NCBI-GeneID: 223593
NCBI-ProteinID: NP_705776
MGI: 2146110
Ensembl: ENSMUSG00000022350
UniProt: Q8C2E7
Position
15:complement(59203712..59246043)
AA seq 1159 aa
MLDFLAENNLCGQAILRIVSCGNAIIAEVLRLSEFIPAVFLLKDRADQQRYGDIIFDFSY
FKGPEFWESKLEAKPELQDLDEEFRENNIEIVTRFYLAFQSVHKYIVDLNRYLDDLNEGV
YIQQTLETVLLSEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVSYYRYSAARSSAD
SNMDDICKLLRSTGYSSQPGAKRPPNYPESYFQRVPINETFISMVIGRLRSDDIYNQVSA
YPLPEHRSTALANQAAMLYVILYFEPSILHTHQAKMREIVDKYFPDNWVISIYMGITVNL
ADAWEPYKAAKTALNNTLDLANVKEQASRYASVSDRVRAQVQQFLKEGYLREEVLLDNIP
RLLNCLRDCNVAIRWLMLHTADSACDPNNKRLRQIKDQILADSRYNPKILFQLLLDTAQF
EFILKEMFKQMLSEKQSKWEHYKKEGSERMTELADVFSGVKPLTRVEKNENLQAWFREIS
KQILSLNYDDSTAAGRKTVQLIQALEEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINI
KEEVLITVQIIGDLSFAWQLIDSFTSIMQESIRVNPSMVTKLRATFLKLASALDLPLLRI
NQANSPDLLSVSQYYSGELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIMEVPTRLDKDK
LRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAF
ALHRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVSIYGLKIWQEEVSRIINY
NVEQECNNFLRTKIQDWQSMYQSTHIPIPKFAPVDESITFIGRLCREILRITDPKMTCYI
DQLNTWYDVKTHQEVTSSRLFSEIQTTLGTFGLNGLDRLLCFMIVKELQNFLSMFQKIIL
KERTVQETLKMLMSAVNPLKSIVANSSKVYLSAITKTQKIWSAYLEAIMKVGQMQILRQQ
IANELNSSCRFDSRHLAAALDNLNKALLADIEAHYRDPSLPYPKEDNTLLYEITAYLEAA
GIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKNLGMVCRKPADPVDWPPLVLGL
LTLLKQFHSRYTEQFLALIGQFIRSTMEQCTSQKMPEMPADAVGALLFLEDYVRYTKLPR
RVAEAHVPNFIFDEFRTVL
NT seq 3480 nt   +upstreamnt  +downstreamnt
atgttggacttcctggctgagaataatctctgtggccaggccatcctgaggatcgtctcc
tgtggcaatgccatcattgccgaggtgctgcggctctctgagttcattcctgctgtgttc
ctgctgaaagaccgggctgaccagcagagatatggagacatcatctttgacttcagctac
tttaagggtccagagttctgggaaagcaaactggaagccaagcctgagctgcaggattta
gatgaagaatttcgggaaaacaacatagaaatcgtgaccagattttatttagcctttcaa
agtgtgcataaatacattgtagacttaaacagatacctcgatgacctcaatgaaggagtt
tatattcagcaaaccttagaaaccgtgcttctcagtgaagatggaaaacaacttctatgt
gaagccctgtacttatatggagttatgctgcttgtcatcgaccagaagattgaaggagaa
gtcagagagagaatgctggtttcttactatcgatacagtgctgctcggtcctctgctgac
tcaaacatggatgatatctgtaagctgctacgaagcacaggatattccagccagccagga
gccaaaagaccacccaactatcctgagagctatttccagagagtgcctatcaacgagacg
ttcatcagcatggtcatcggacgcctgaggtctgatgacatttacaaccaggtctctgcc
tacccgctgccggagcaccgcagcactgccctggccaatcaagccgccatgctctacgtg
attctctattttgaaccttccattcttcacacccaccaagcaaaaatgagagagatcgtg
gataagtactttccagataactgggtaatcagcatctatatgggtatcactgttaatcta
gctgatgcctgggaaccttacaaagctgcgaaaactgctctcaacaacacccttgacctc
gccaatgtcaaagaacaggcaagcagatacgctagtgtcagcgacagagtgcgcgctcag
gtgcagcagtttctgaaagagggctacctgagggaggaggtgcttctggacaacatcccc
aggctgctgaactgcctgagagactgcaatgtcgccatccgctggctaatgctccacaca
gccgactcagcctgtgacccaaacaacaagcgccttcgtcaaatcaaggaccagattctg
gcagactctaggtacaatcccaagatcctcttccagttgctattggacactgcacaattc
gagtttatactcaaagagatgttcaagcaaatgctttccgagaaacagtccaagtgggag
cattacaagaaggagggctctgagcgcatgaccgagcttgctgacgtcttttcaggggtg
aaaccactaacccgagtggagaaaaacgaaaatcttcaagcttggttcagagagatctca
aaacaaatactgtctctaaattatgatgattctactgctgcaggcagaaaaactgtgcaa
ctaatacaagctctggaagaggttcaggagtttcaccagttggaatcaaatctacaagtt
tgccagtttctagctgacacccgaaagtttctccatcaaatgatcagaaccatcaacatc
aaggaggaagtcctgatcacagtgcagatcatcggggacctttcctttgcctggcagtta
attgacagtttcacatccatcatgcaagaaagcataagggtaaacccatccatggttacc
aaactcagagccacgttcctaaagcttgcctctgcccttgaccttcccctgctacgtatt
aatcaagcaaatagccctgatctcctcagtgtgtctcagtattattcaggagaattggtg
tcatacgtgagaaaggttttgcagatcattccagaaagcatgttcacatctctcctgaag
atcataaagcttcagacccatgacatcatggaagtgcctacacgcctggacaaggacaag
ctgcgggactacgctcagcttggcccgagatatgaggttgccaagctcactcacgccatc
tccatctttactgagggcatcttgatgatgaaaacgaccctggtgggcatcatcaaggtg
gatcccaagcagttgctggaagacggaataaggaaagagctggttaaacgcgtggctttc
gcccttcaccggggactgatattcaaccctcgtgccaagccaagtgagttgatgcccaaa
ctgaaagagctgggggccaccatggatgggttccatcgctcctttgagtatatacaggac
tacgtcagcatttacggtctgaagatttggcaggaggaagtctctcgtattataaattat
aacgtggaacaggagtgtaataacttcttaagaacaaagattcaagactggcagagtatg
taccaatccactcatataccaatcccgaagtttgcacctgtggatgagtctataacattt
attggtcgactctgcagagaaatcttgcggatcacagacccaaaaatgacatgttacata
gaccagctgaacacttggtatgacgtgaaaactcatcaagaagtgaccagcagtcgcctc
ttctcagaaatccagaccaccttggggacttttggtctgaatggattggacaggcttctg
tgcttcatgattgtgaaagagctacagaatttcctcagtatgtttcagaaaattatcctg
aaagagagaactgttcaagaaactttaaagatgctcatgagtgctgttaaccctctaaag
agcatagtggcaaattcaagtaaagtttatctttctgccatcaccaaaacacagaagatc
tggagtgcttacctggaggctataatgaaggttggacagatgcagatcctgagacaacag
atcgccaatgagctaaactcttcctgtcgatttgattccagacatctggcagctgccctg
gataatctcaataaggctctcctggcagacatcgaagcccactaccgggacccttcgctt
ccttaccccaaagaagataacacactcttatatgaaatcacagcctatctggaggcggct
ggcattcacaaccccctgaataagatttacataacaacgaagcgcttaccctatttcccg
attgtcaactttctgtttttgatcgcgcagttgccaaaacttcagtataacaaaaatcta
ggcatggtctgccggaagcctgccgaccctgttgactggccaccgctcgtcctaggtctg
ctcacgctgctgaagcagttccactcccggtacaccgagcaattcctggcactgattggc
cagtttattcgctccacaatggagcagtgcacaagccagaagatgcctgaaatgcctgca
gatgctgtgggcgcccttctcttcctggaggattatgttcggtatacaaaactcccccga
agggtggctgaagcccatgtgcctaacttcatttttgatgaattccgaacagtcctgtga

DBGET integrated database retrieval system