KEGG   Mus musculus (mouse): 223604Help
Entry
223604            CDS       T01002                                 

Gene name
Kcnk9, A930009L07Rik, Task3
Definition
(RefSeq) potassium channel, subfamily K, member 9
  KO
K04919  potassium channel subfamily K member 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    223604 (Kcnk9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    223604 (Kcnk9)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   223604 (Kcnk9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans_2 Ion_trans IRK
Motif
Other DBs
NCBI-GeneID: 223604
NCBI-ProteinID: NP_001029048
MGI: 3521816
Ensembl: ENSMUSG00000036760
UniProt: Q3LS21
Position
15; 15 D3
AA seq 402 aa AA seqDB search
MKRQNVRTLSLIACTFTYLLVGAAVFDALESDHEMREEEKLKAEEVRLRGKYNISSDDYQ
QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL
TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTEVSMENMVTVGFFSCMGTLCLGAAAFSQ
CEDWSFFHAYYYCFITLTTIGFGDFVALQAKGALQRKPFYVAFSFMYILVGLTVIGAFLN
LVVLRFLTMNTDEELLEGEVAEILAGNPRRVSVRAPQRRKRHHAMYFLRKYGRTLCYLCF
PGTNWGKDDDDDDDDDVVDNVVVTAPISAPAPAPAPAPAPAAVAAGATIRSVRATVHTVS
CRVEEIPPDVLRNTYFRSVFGAIPPGMHTCGDHRLHLRRKSI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggcagaacgtgcgtaccctgtccttgatcgcctgtaccttcacctacctgctg
gtcggtgccgcggtgttcgacgccctcgagtcggaccatgagatgcgcgaggaggagaaa
cttaaagccgaagaagtccgtctcagaggcaagtacaacatcagctccgatgactaccag
cagctggagctggtaatcctgcagtctgagccccaccgcgctggtgtccagtggaaattc
gccggttccttctacttcgccatcactgtcatcacaactatcggatatggacatgctgca
cctggaactgatgctggcaaggccttctgtatgttctacgctgtgctgggtatccccctg
acgctggttatgttccagagcctgggcgagcgcatgaacaccttcgtgcgctacctgctg
aaacgtatcaagaagtgctgtggcatgcgcaacactgaagtttctatggagaacatggtg
accgtcggcttcttttcctgcatgggcaccctgtgccttggggcggctgccttttcccag
tgtgaagattggagcttcttccatgcctactactactgcttcataacattgactactata
gggttcggcgattttgtggccctgcaggccaagggtgcgctgcagaggaagccattctat
gtggccttcagcttcatgtatatcctggtgggcctgaccgtcatcggtgccttcctcaat
cttgtggtcctgcgattcctgaccatgaataccgatgaggagctactggagggagaagtt
gcggagattcttgctggaaatccaagaagagtgtctgtccgtgcgcctcagagacgcaag
aggcaccacgccatgtacttcctcaggaaatacggcagaaccctgtgctatctctgcttc
cctggtaccaactggggtaaagatgatgacgatgatgatgatgatgatgtcgtcgataat
gttgttgttactgctcctatttctgctcctgcgcctgctcctgctcctgcgcctgctcct
gctgctgtggctgctggtgccactatcaggagtgtccgggctaccgtccacaccgtttcc
tgcagggttgaagagatccctccagacgtgctgaggaacacctacttccggtccgttttc
ggcgccattcctcctggaatgcacacctgcggggaccataggctgcacctccgtcgcaag
tccatctaa

DBGET integrated database retrieval system